KEGG   Chlorobaculum tepidum: CT0306Help
Entry
CT0306            CDS       T00088                                 

Gene name
rfbC
Definition
dTDP-4-dehydrorhamnose 3,5-epimerase
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
cte  Chlorobaculum tepidum
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Polyketide sugar unit biosynthesis [PATH:cte00523]
Metabolism; Biosynthesis of other secondary metabolites; Streptomycin biosynthesis [PATH:cte00521]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
CyanoBase: 
CYORF: 
UniProt: 
Position
320292..320849
Genome map
AA seq 185 aa AA seqDB search
MQIIRTSIPDVLLFEPEVFGDERGWFCESFRQDIFEQHAGCHRFVQDNESFSRYGVVRGL
HYQKPPHVQGKLVRVIRGEVLDVAVDIRKGSPTFGHHTAQLLNESNRRMMWIPPGFAHGF
AVLSQTAVFSYKCTDYYAPSHDAGIRWNDPAIGIEWSVPESEIRLSDKDLHHPMLHEIEG
IVLDA
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
atgcagatcatccggacctcaattcctgacgttcttctgttcgaaccagaggtgttcggc
gatgaacgcggctggttttgcgaatctttccgtcaggatatattcgagcaacacgccgga
tgccaccgtttcgtgcaggataacgaatcgttttcacgctatggcgttgtccggggtttg
cattaccagaaaccgccgcatgtgcagggcaagcttgtccgtgtgatccggggtgaggtg
cttgatgtggctgtcgatatacgcaagggttctccaacattcggccatcatactgcccag
ttgctcaatgagagcaaccgccggatgatgtggattccgcccggattcgcccacggcttt
gcggtgctgagccagacagcggtgttcagttataaatgcacggactattatgcgccatca
cacgatgcgggcatccggtggaacgatccggccattggcatagaatggagcgtgccggaa
agcgagataaggctttcggataaggatcttcatcatccgatgctgcacgagattgaaggt
attgtgctggacgcgtag

DBGET integrated database retrieval system