KEGG   Chlorobium tepidum: CT0380Help
Entry
CT0380            CDS       T00088                                 

Gene name
sucC
Definition
(RefSeq) succinyl-CoA synthetase subunit beta
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
cte  Chlorobium tepidum
Pathway
cte00020  Citrate cycle (TCA cycle)
cte00640  Propanoate metabolism
cte00660  C5-Branched dibasic acid metabolism
cte00720  Carbon fixation pathways in prokaryotes
cte01100  Metabolic pathways
cte01110  Biosynthesis of secondary metabolites
cte01120  Microbial metabolism in diverse environments
cte01130  Biosynthesis of antibiotics
cte01200  Carbon metabolism
Module
cte_M00009  Citrate cycle (TCA cycle, Krebs cycle)
cte_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
cte_M00173  Reductive citrate cycle (Arnon-Buchanan cycle)
cte_M00614  Anoxygenic photosynthesis in green sulfur bacteria
Brite
KEGG Orthology (KO) [BR:cte00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CT0380 (sucC)
   00640 Propanoate metabolism
    CT0380 (sucC)
   00660 C5-Branched dibasic acid metabolism
    CT0380 (sucC)
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    CT0380 (sucC)
Enzymes [BR:cte01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     CT0380 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A DUF3182 ATP-synt_DE
Motif
Other DBs
NCBI-GeneID: 1008043
NCBI-ProteinID: NP_661284
CyanoBase: CT0380
CYORF: CT0380
UniProt: Q8KFE7
Position
complement(392817..393995)
Genome map
AA seq 392 aa AA seqDB search
MNIHEYQGKGILKQFGVAVPKGIVAFSAEEAKQAAEQLFEEQSSPVVVVKAQIHAGGRGK
AGGVKLAKSPEEVFEIAQKMLGATLVTHQTGPEGKEVRRLLIEEGMNIDKEFYLGITLDR
TTSSNVLMVSTEGGMEIEKVAEETPEKLLKIHVDPVYGLQGFQARKAAFFLGLQGEQFRN
GVKFIEALYNAYTTIDASLAEINPLVITKEGRVLALDAKINFDDNALYRHSDFHDLRDIT
EEDPLEYEASKSNLNYVRLDGNVGCMVNGAGLAMGTMDLIQLSGGRPANFLDVGGGASSK
TVEEGFKIILGDKNVKAILVNIFGGIVRCDRVAGGIIEAAKNIGLKVPVIVRLEGTNATE
AQKMLDESGLNLISAKGLRDAAEKVQKALATA
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgaatattcatgagtatcagggtaaaggcatcctgaaacagttcggcgtggccgttccc
aagggcatagtagcattttcggctgaagaagcaaaacaagcggcagagcagctcttcgag
gagcagtcgagccccgtagtggtcgtcaaggcgcagattcacgccggtggccgcggcaag
gctggcggtgtcaaactggcaaaatcgcctgaagaggtgttcgaaatcgcccagaaaatg
ctcggcgcaacgctggtaacacaccagaccggacccgaaggcaaggaggttcgccgtctc
ctcatcgaagagggcatgaatatcgacaaggagttctacctcggcatcaccctcgaccgc
accacgtcgagcaacgtgctcatggtctcgaccgaaggcggcatggagatcgagaaagtg
gccgaagagaccccagaaaagctgctcaagattcacgtcgatccagtctacggcctgcag
ggcttccaggctcgcaaggcggcgttcttcctcggcttgcagggtgagcagttccgcaac
ggcgtcaagttcatcgaggcgctttacaacgcgtacaccaccatcgacgcctcgctggct
gagatcaacccgctggtcatcaccaaggagggccgcgtgctcgcgctcgacgccaagatc
aacttcgacgacaacgccctctaccgccactctgatttccacgatctgcgtgacattacc
gaagaggatccgctcgaatacgaagcctcgaaatcgaacctcaactacgtgcgcctcgac
ggcaacgttggctgcatggtcaacggcgcaggcctggcgatgggcaccatggacctcatc
cagctctccggcggcagaccggccaacttccttgatgtcggcggcggtgcaagctccaag
acagtcgaagagggtttcaaaatcatcttgggcgacaaaaacgtcaaggcgatcctggtc
aacatcttcggcggcatcgtacgctgcgaccgcgtggccggaggcatcatcgaagccgcc
aaaaacatcggcctgaaggtaccggtgatcgtgcgcctcgaaggcacaaacgccacagag
gcccagaaaatgctcgacgaatcgggtctcaacctcatctcggccaaaggcctgagggac
gctgcggaaaaggtgcagaaggcactggccacagcataa

DBGET integrated database retrieval system