KEGG   Chlorobium tepidum: CT0380Help
Entry
CT0380            CDS       T00088                                 

Gene name
sucC
Definition
(RefSeq) succinyl-CoA synthetase subunit beta
  KO
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
cte  Chlorobium tepidum
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Reductive citrate cycle (Arnon-Buchanan cycle)
Anoxygenic photosynthesis in green sulfur bacteria
Brite
KEGG Orthology (KO) [BR:cte00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CT0380 (sucC)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CT0380 (sucC)
   00640 Propanoate metabolism
    CT0380 (sucC)
   00660 C5-Branched dibasic acid metabolism
    CT0380 (sucC)
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    CT0380 (sucC)
Enzymes [BR:cte01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     CT0380 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(392817..393995)
Genome map
AA seq 392 aa AA seqDB search
MNIHEYQGKGILKQFGVAVPKGIVAFSAEEAKQAAEQLFEEQSSPVVVVKAQIHAGGRGK
AGGVKLAKSPEEVFEIAQKMLGATLVTHQTGPEGKEVRRLLIEEGMNIDKEFYLGITLDR
TTSSNVLMVSTEGGMEIEKVAEETPEKLLKIHVDPVYGLQGFQARKAAFFLGLQGEQFRN
GVKFIEALYNAYTTIDASLAEINPLVITKEGRVLALDAKINFDDNALYRHSDFHDLRDIT
EEDPLEYEASKSNLNYVRLDGNVGCMVNGAGLAMGTMDLIQLSGGRPANFLDVGGGASSK
TVEEGFKIILGDKNVKAILVNIFGGIVRCDRVAGGIIEAAKNIGLKVPVIVRLEGTNATE
AQKMLDESGLNLISAKGLRDAAEKVQKALATA
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgaatattcatgagtatcagggtaaaggcatcctgaaacagttcggcgtggccgttccc
aagggcatagtagcattttcggctgaagaagcaaaacaagcggcagagcagctcttcgag
gagcagtcgagccccgtagtggtcgtcaaggcgcagattcacgccggtggccgcggcaag
gctggcggtgtcaaactggcaaaatcgcctgaagaggtgttcgaaatcgcccagaaaatg
ctcggcgcaacgctggtaacacaccagaccggacccgaaggcaaggaggttcgccgtctc
ctcatcgaagagggcatgaatatcgacaaggagttctacctcggcatcaccctcgaccgc
accacgtcgagcaacgtgctcatggtctcgaccgaaggcggcatggagatcgagaaagtg
gccgaagagaccccagaaaagctgctcaagattcacgtcgatccagtctacggcctgcag
ggcttccaggctcgcaaggcggcgttcttcctcggcttgcagggtgagcagttccgcaac
ggcgtcaagttcatcgaggcgctttacaacgcgtacaccaccatcgacgcctcgctggct
gagatcaacccgctggtcatcaccaaggagggccgcgtgctcgcgctcgacgccaagatc
aacttcgacgacaacgccctctaccgccactctgatttccacgatctgcgtgacattacc
gaagaggatccgctcgaatacgaagcctcgaaatcgaacctcaactacgtgcgcctcgac
ggcaacgttggctgcatggtcaacggcgcaggcctggcgatgggcaccatggacctcatc
cagctctccggcggcagaccggccaacttccttgatgtcggcggcggtgcaagctccaag
acagtcgaagagggtttcaaaatcatcttgggcgacaaaaacgtcaaggcgatcctggtc
aacatcttcggcggcatcgtacgctgcgaccgcgtggccggaggcatcatcgaagccgcc
aaaaacatcggcctgaaggtaccggtgatcgtgcgcctcgaaggcacaaacgccacagag
gcccagaaaatgctcgacgaatcgggtctcaacctcatctcggccaaaggcctgagggac
gctgcggaaaaggtgcagaaggcactggccacagcataa

DBGET integrated database retrieval system