KEGG   Chlorobium tepidum: CT0399Help
Entry
CT0399            CDS       T00088                                 

Gene name
gpmA
Definition
(RefSeq) phosphoglyceromutase
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
cte  Chlorobium tepidum
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:cte00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CT0399 (gpmA)
   01230 Biosynthesis of amino acids
    CT0399 (gpmA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CT0399 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    CT0399 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CT0399 (gpmA)
Enzymes [BR:cte01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     CT0399 (gpmA)
Exosome [BR:cte04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   CT0399 (gpmA)
  Exosomal proteins of melanoma cells
   CT0399 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
412646..413389
Genome map
AA seq 247 aa AA seqDB search
MKKLVLLRHGESQWNRENRFTGWVDVDLSEKGREEARTAGQLLKDEGFVFDLAYTSVLKR
AIRTLWTVLDEMNLMWIPVTKNWRLNERHYGALQGLNKAETAQRHGDEQVLIWRRSYDTP
PPALTESDEFWPGKDPRYASLSSQELPATECLKDTVARFLPYWHETIAPQIRDGKNVIIT
AHGNSLRALVKYLDNISDEDIVGLNIPTGIPLVYELDDDLKPLKSYYLGDQEELKKKVEV
VVKQGKA
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaacttgtcctgctgaggcacggcgaaagccagtggaaccgggagaaccgtttc
accggatgggtggatgttgatctttccgagaaaggaagagaagaggcgagaaccgctggc
cagctgctcaaggatgagggtttcgtgtttgacctcgcctacacttcggtgctcaagcgc
gccatcaggacgctctggacggtgctcgacgagatgaatctcatgtggattcccgtcaca
aaaaactggcgtctcaacgaacgccattacggagcattgcaggggctcaacaaggcagag
actgcccagcgccacggcgacgagcaggtgctgatctggcgccgcagctacgacacgccg
ccaccggctctcaccgagagcgatgagttctggccgggcaaggacccgcgctatgcttcg
ctgtcctctcaggaactgcctgccacggagtgcctgaaggatacggttgcgcgcttcctt
ccctactggcacgagactattgcaccgcagattcgcgatggcaagaatgtcattattaca
gctcacggtaattcgctcagggcgctggtcaaatatctcgacaacatttcggatgaggat
atcgtcggtctgaacattcctaccggtattccgctggtgtacgagcttgacgacgatctc
aagccgctgaagagttactatctgggcgaccaggaggagctgaagaaaaaggtggaggtc
gtcgtcaaacagggcaaagcctga

DBGET integrated database retrieval system