KEGG   Chlorobium tepidum: CT0399Help
Entry
CT0399            CDS       T00088                                 

Gene name
gpmA
Definition
phosphoglyceromutase
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
cte  Chlorobium tepidum
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:cte00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CT0399 (gpmA)
   01230 Biosynthesis of amino acids
    CT0399 (gpmA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CT0399 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    CT0399 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CT0399 (gpmA)
Enzymes [BR:cte01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     CT0399 (gpmA)
Exosome [BR:cte04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   CT0399 (gpmA)
  Exosomal proteins of melanoma cells
   CT0399 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
CyanoBase: 
CYORF: 
UniProt: 
Position
412646..413389
Genome map
AA seq 247 aa AA seqDB search
MKKLVLLRHGESQWNRENRFTGWVDVDLSEKGREEARTAGQLLKDEGFVFDLAYTSVLKR
AIRTLWTVLDEMNLMWIPVTKNWRLNERHYGALQGLNKAETAQRHGDEQVLIWRRSYDTP
PPALTESDEFWPGKDPRYASLSSQELPATECLKDTVARFLPYWHETIAPQIRDGKNVIIT
AHGNSLRALVKYLDNISDEDIVGLNIPTGIPLVYELDDDLKPLKSYYLGDQEELKKKVEV
VVKQGKA
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaacttgtcctgctgaggcacggcgaaagccagtggaaccgggagaaccgtttc
accggatgggtggatgttgatctttccgagaaaggaagagaagaggcgagaaccgctggc
cagctgctcaaggatgagggtttcgtgtttgacctcgcctacacttcggtgctcaagcgc
gccatcaggacgctctggacggtgctcgacgagatgaatctcatgtggattcccgtcaca
aaaaactggcgtctcaacgaacgccattacggagcattgcaggggctcaacaaggcagag
actgcccagcgccacggcgacgagcaggtgctgatctggcgccgcagctacgacacgccg
ccaccggctctcaccgagagcgatgagttctggccgggcaaggacccgcgctatgcttcg
ctgtcctctcaggaactgcctgccacggagtgcctgaaggatacggttgcgcgcttcctt
ccctactggcacgagactattgcaccgcagattcgcgatggcaagaatgtcattattaca
gctcacggtaattcgctcagggcgctggtcaaatatctcgacaacatttcggatgaggat
atcgtcggtctgaacattcctaccggtattccgctggtgtacgagcttgacgacgatctc
aagccgctgaagagttactatctgggcgaccaggaggagctgaagaaaaaggtggaggtc
gtcgtcaaacagggcaaagcctga

DBGET integrated database retrieval system