KEGG   Chlorobaculum tepidum: CT0421Help
Entry
CT0421            CDS       T00088                                 

Definition
(RefSeq) magnesium-chelatase subunit I family protein
  KO
K03405  magnesium chelatase subunit I [EC:6.6.1.1]
Organism
cte  Chlorobaculum tepidum
Pathway
cte00860  Porphyrin and chlorophyll metabolism
cte01100  Metabolic pathways
cte01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cte00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    CT0421
Enzymes [BR:cte01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     CT0421
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mg_chelatase AAA_5 MCM Sigma54_activat AAA_16 AAA_3 AAA AAA_22
Motif
Other DBs
NCBI-GeneID: 1008138
NCBI-ProteinID: NP_661325
CyanoBase: CT0421
CYORF: CT0421
UniProt: Q8KFA6
Position
438915..439958
Genome map
AA seq 347 aa AA seqDB search
MKKNYTYPFTAIVGQEEMKLALILNIINPAISGVLIRGEKGTAKSTAVRALADILPEIEV
IAGIPFNLAPDEDDETIRECFTVTGHAMPDPDNLEVTMHKVQVVELPVGATEDRVVGTLD
LEHALKTGEKRIEPGLLAAAHRGILYVDEVNLLDDHVVDVLLDSAAMGVNTIEREGVSFS
HPARFTLVGTMNPEEGELRPQLLDRFGLCVHVGGIADPQDRVTVMERRFAFEQDQERFCS
EWQGESSKLAERIVAARELYPSVTISREHLLGIAKSCLKVGVDGHRGDIIIMKTAKTIAA
WEGRHCVGSDDIDRAVALALPHRIRRQPLQDMVMDVGSLLGSKCTTN
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagaactacacctatccctttacggccattgtcggtcaggaagagatgaagctc
gcgctgattctcaacatcatcaatccggccatctccggcgtgctcatccgcggcgagaag
gggacggccaaatcgaccgccgtccgggcgctggccgatattctgccggagatcgaggtg
attgccggaattcccttcaatctcgcgcccgacgaggatgacgaaacgatccgcgagtgc
tttacggtgacgggtcacgctatgcccgatccggacaacctcgaggttaccatgcacaag
gtgcaggtggtcgagctgccggtgggcgcgaccgaggatcgtgtggtcggcacactcgat
ctcgaacatgcgctcaagacgggcgaaaagcgcatcgagccgggccttctcgccgccgcg
caccggggcattctgtatgtcgatgaggtgaacctgcttgatgaccacgtggttgatgtg
ctgctcgactcggcggcgatgggggtgaacactatcgagcgcgaaggggtctccttttcc
cacccggcccgtttcacgctggttggcaccatgaacccggaagagggtgagctgcgtccg
cagttgctcgaccgcttcggactctgcgttcacgtcggcggcatcgctgatccgcaggat
cgcgtgacggtcatggagcgccgtttcgctttcgaacaggatcaggagcgcttctgcagc
gagtggcagggtgaatcgtcgaagcttgctgaacgcatcgtcgcggcacgcgagctttat
ccctccgtcacgatcagccgcgagcacctgcttggcattgccaaaagctgcctcaaagtg
ggcgttgacggccatcgcggcgacatcatcatcatgaagaccgccaagaccatcgccgcc
tgggagggccgtcattgcgtcggcagcgacgacatcgaccgcgccgtcgccctcgcgctg
ccccaccgcatccgccgccagccgttgcaggacatggtgatggatgtcggctcgttgctg
gggtcaaagtgcacgaccaactaa

DBGET integrated database retrieval system