KEGG   Chlorobium tepidum: CT0521Help
Entry
CT0521            CDS       T00088                                 

Gene name
trpB-1
Definition
(RefSeq) tryptophan synthase subunit beta (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
cte  Chlorobium tepidum
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cte00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    CT0521 (trpB-1)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CT0521 (trpB-1)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CT0521 (trpB-1)
Enzymes [BR:cte01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     CT0521 (trpB-1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(527030..528232)
Genome map
AA seq 400 aa AA seqDB search
MKQKVIYSAPDEFGHFGTFGGKFIPETLVKNAADLEEEYLKAKNDPEFHQTLDNLLRHYV
GRPTPLYHASRLSEKQGGAQIWLKREDLCHTGAHKINNALGQVLLAKRMGKKRIIAETGA
GQHGVATATVCALFGLDCIVYMGEEDIRRQAPNVARMKLLGTEVRPVTAGSRTLKDATSE
AIRDWMNNPEETFYIVGSVIGMHPYPMMVRDFQSVIGRETRQQVLDQAGRLPDVIVACVG
GGSNAIGMFYEFLPDAKEVELIGVEAAGEGLEGKHAASLTKGEIGVLHGSMMKLLQDEYG
QVQEAHSISAGLDYPGVGPEHCYLQKLGLVCYTSTTDKEALAALDALAKTEGIICALESA
HAVHYAMKRAAEMPKESIIVVNLSGRGDKDMGTIMQELKL
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgaagcagaaggttatctactccgcacccgatgaattcggccacttcggcaccttcgga
ggcaaattcattcccgaaaccctggtcaaaaacgccgccgatctcgaagaggagtacctc
aaggcgaaaaatgatccggagttccaccaaacgctcgacaacctgcttcgccactacgtt
ggccgcccgacgccgctctatcacgcctcgcggctcagcgaaaagcagggcggcgcccag
atctggctcaagcgcgaagacctctgccacaccggcgcgcacaagatcaacaacgccctc
ggccaggtgctgctggccaaacggatgggcaaaaagcgcatcatcgccgaaaccggcgcg
ggccagcatggcgtggcaacggccaccgtctgcgcgctcttcggtctcgactgcatcgtc
tatatgggcgaagaggacatccgccgccaggctcccaacgtggcgcgcatgaagctgctc
ggcacagaggtgcgcccggtcacggcaggcagcagaacgctgaaggacgccaccagcgag
gcaatccgcgactggatgaacaatcccgaagagaccttctacatcgttggctcggtgatc
ggaatgcacccgtacccgatgatggtacgcgacttccagtcggtcatcggacgcgaaacc
cgccagcaggtgctcgatcaggccgggcgcttgcccgatgtgatcgtggcctgcgtcggc
ggcggcagcaacgccatcggcatgttctacgagtttttgccggatgccaaagaggtcgaa
ctgatcggcgtcgaagccgccggagagggactcgaaggcaagcacgccgcgtcgctgaca
aagggtgaaatcggcgtgctgcacggctcgatgatgaagctcttgcaggacgagtacggt
caggtgcaggaggcgcactcgatttcggcgggactcgactaccccggcgtcggtccggag
cactgctatttgcagaagctcggcctggtctgctatacctcgacgacagacaaggaagcc
ctcgcagcgctcgacgctctggccaaaaccgaaggcatcatctgcgccctcgaatcggct
cacgccgtgcattatgcgatgaaacgagccgccgaaatgccgaaagagtcgatcatcgtg
gtcaacctctctggccgcggcgacaaagacatgggtaccatcatgcaggagctgaagctg
taa

DBGET integrated database retrieval system