KEGG   Chlorobium tepidum: CT0535Help
Entry
CT0535            CDS       T00088                                 

Gene name
trpA
Definition
(RefSeq) tryptophan synthase subunit alpha (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
cte  Chlorobium tepidum
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cte00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    CT0535 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CT0535 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CT0535 (trpA)
Enzymes [BR:cte01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     CT0535 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
542208..543011
Genome map
AA seq 267 aa AA seqDB search
MKENRITRLVKQDKKLLIAYYMPEFPVPGATLPVLEALQESGVDLIELGMPYSDPIGDGS
VIQDAAHKAISHGVHVGSIFELVRRARNGEGCKKITTPILLMGYCNPLIAYGGDCFMADA
VKAGVDGLLIPDLPPEESEDFLERAKHFGLSVIYLISPVTPPDRIELIDSMSTDFSYCLA
VNATTGTGKLDVAGMDEKIAEYLKRVRQHTKKKFVVGFGIKDRERVRKMWELADGAVVGS
ALLQHVATAKTPEETAELAAGFWKSLR
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgaaagagaaccgaattacccggctggtgaagcaggacaagaagctgctcatcgcctat
tatatgcctgaatttcccgtgccgggcgctactttgcctgtgcttgaagcgttgcaggag
agcggggtcgatctcatcgagctcggtatgccctactccgatcccattggcgacgggtcg
gtgatccaggacgcggcgcacaaggcgatcagccatggcgtgcatgttggcagcatcttc
gagctggtcagaagagcgcgcaatggcgaggggtgcaagaagatcaccacgccgattctg
cttatgggttactgcaatccgctcatcgcctacggcggcgactgtttcatggccgatgcg
gtgaaggcgggcgtggatgggttgctgattcccgacctgccgcccgaggagtcggaggat
ttcctcgaacgcgccaaacacttcggcctgtcggtgatctacctcatttcgccggtgacg
ccgcctgaccgtatcgagctgatcgacagcatgtccaccgacttttcgtattgcctcgcg
gttaacgccaccaccgggaccggcaagctcgacgttgcaggcatggacgagaagatcgcc
gagtatctaaagcgcgtgcggcagcacacgaaaaagaagttcgtcgtcggctttggcatc
aaggatcgcgagcgtgtgcgcaagatgtgggagctggccgacggcgcggtggtcggctcg
gcgctgctgcaacacgtcgccacagcgaaaacccccgaagagactgcggagctggccgcc
gggttctggaaatcgctgcggtga

DBGET integrated database retrieval system