KEGG   Chlorobaculum tepidum: CT0546Help
Entry
CT0546            CDS       T00088                                 

Gene name
hisD
Definition
(RefSeq) histidinol dehydrogenase
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
cte  Chlorobaculum tepidum
Pathway
cte00340  Histidine metabolism
cte01100  Metabolic pathways
cte01110  Biosynthesis of secondary metabolites
cte01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:cte00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    CT0546 (hisD)
Enzymes [BR:cte01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     CT0546 (hisD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh
Motif
Other DBs
NCBI-GeneID: 1006212
NCBI-ProteinID: NP_661446
CyanoBase: CT0546
CYORF: CT0546
UniProt: Q8KEY6
Position
complement(554334..555620)
Genome map
AA seq 428 aa AA seqDB search
MLTIYHFPQDEAALREQLNRTVSFDPDAQRTVDDILYRVRTEGDAAVLDYTERFQGIRLY
DMRVPEAEIEAAYAAADPEFIAILEEAFANITAFHRNEAEKSFFYEQKGGVILGQRVTPM
EKALLYVPGGKAAYPSSVLMNAAPAQVAGVDEISMTTPCDAEGKVNPHILAAAKVAGITS
VYRLGGAQAVAAFAYGTATIPKVDIVTGPGNKYVALAKKQVFGHVAIDSIAGPSEVVVIA
DAGAEPEFIVMDMFAQAEHDPDASAVLITPSAELADAVRETAARLAGTMLRGEVITRALT
DNGAIVVTGSMQEACKVSDMIAPEHLELHVDNPWEILPDLRHAGAIFMGQWSCETVGDYF
AGPNHTLPTNGTARFFSPLSVRDFVKHTSIIAWSKSELARTGEKIARFADHEGLQAHAEA
VRVRLKHL
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
gtgctaacgatctaccatttcccccaggacgaggcagccctcagagaacagctcaaccgg
acggtatcgtttgatcccgatgcccagcggacggtcgatgacattctgtatcgcgtcaga
acggagggcgatgccgccgtgctcgactataccgagcgcttccaggggatacggctctat
gacatgcgggtgccggaagcggagatcgaggcggcgtacgcggcggctgatccggagttc
atcgccattctcgaagaggcgtttgcaaacatcacggcgttccatcgcaacgaggcggag
aaaagctttttctacgaacagaagggtggcgtcatcctcggccagcgcgtcacgccgatg
gagaaggcgctgctctacgtgcccggcggcaaagccgcctacccctcgtcggtgctgatg
aatgccgcgcctgcgcaggtggccggcgtcgatgaaatctccatgaccaccccgtgcgac
gctgagggcaaggtcaatccgcacatcctcgctgccgcgaaagtcgccggcatcaccagc
gtctatcgcctcggcggggcacaggccgtggcggcgttcgcctacggcacggcgaccatt
ccgaaggttgacatcgtcaccggccctggcaataaatatgtcgcactcgccaagaagcag
gtgttcggccacgtcgccatcgacagtatcgccgggccgtcagaagtggtggttatcgcc
gacgcaggcgcggagccggaattcatcgtgatggacatgttcgcgcaggccgagcacgat
cccgacgcatcagcggtgctcatcacgccatccgccgagctggccgacgccgtgcgggag
actgctgctcgccttgcgggcacgatgcttcgtggcgaggtgatcactcgcgcgctcacg
gataacggcgcgattgttgtaaccggttcgatgcaggaagcgtgcaaggtgtctgacatg
atcgctcccgagcacctcgaactgcacgttgacaatccctgggagattctgcctgacctg
cgtcatgccggagcgattttcatggggcagtggtcgtgcgaaacggtcggcgattatttt
gccggaccgaaccacacgctgccaaccaacggcacggcgcgattcttctcgccgctctcg
gtgcgcgacttcgtcaaacacacctcgatcatcgcctggtcgaagagcgagcttgcccgc
accggggagaagatcgcccgcttcgccgaccatgaagggcttcaggctcacgccgaggcg
gttcgcgtcagactgaaacacctgtaa

DBGET integrated database retrieval system