KEGG   Chlorobaculum tepidum: CT0781Help
Entry
CT0781            CDS       T00088                                 

Gene name
folE
Definition
(RefSeq) GTP cyclohydrolase I
  KO
K01495  GTP cyclohydrolase IA [EC:3.5.4.16]
Organism
cte  Chlorobaculum tepidum
Pathway
cte00790  Folate biosynthesis
cte01100  Metabolic pathways
Module
cte_M00843  L-threo-Tetrahydrobiopterin biosynthesis, GTP => L-threo-BH4
Brite
KEGG Orthology (KO) [BR:cte00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    CT0781 (folE)
Enzymes [BR:cte01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     CT0781 (folE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydroI QueF DUF3638
Motif
Other DBs
NCBI-GeneID: 1006416
NCBI-ProteinID: NP_661676
CyanoBase: CT0781
CYORF: CT0781
UniProt: Q8KEA8
Position
complement(753494..754168)
Genome map
AA seq 224 aa AA seqDB search
MKQEKTVSPTVENNRSAESRLSQCDLDECFDESHDRDEEVLGSMTDAVYSLLKGVGEDPE
REGLLLTPERVAKSLRFLTKGYRQDPEQLLKKAVFTESYDEMVLVKDIDIYSMCEHHMLP
FFGKAHVAYIPDGKIVGLSKIPRVVEVFARRLQVQERLTQQIRDAIQNVLNPRGVAVVIE
ATHMCMVMRGVEKQNAVTTTSAMSGDFMTSQSTRSEFLRLIGNH
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaggaaaaaacagtgtcacctaccgtggagaataaccgatctgcagaatcacga
ctttcgcaatgcgatctcgatgagtgcttcgacgagtcgcatgatcgtgacgaggaggtg
ctcgggtcgatgaccgacgccgtatacagcttgctgaaaggggttggcgaggatccggag
cgcgaaggattgctcctgacccccgagcgggtggccaaatccctgcgattcctgacgaag
ggataccggcaggatccagagcagttgctcaaaaaagcggtgttcacagagtcgtacgac
gagatggtgctggtgaaggacatcgatatttactcgatgtgcgaacaccacatgctcccc
ttcttcggcaaggcgcacgtggcctacattcccgatggcaagatcgtgggcttatcgaaa
attccaagagtcgtcgaggtgttcgcgcggcgcttgcaggtacaggagcggctaacccag
cagatcagggacgccattcagaatgtgctcaacccgcgcggtgtggccgtggtaatcgaa
gcgacacacatgtgcatggtgatgcgcggcgtggagaagcagaacgcggtgacgacaacc
tccgccatgtccggagatttcatgaccagccagtctacccgaagcgagttcctgcgcctg
atcggcaaccactga

DBGET integrated database retrieval system