KEGG   Chlorobium tepidum: CT0806Help
Entry
CT0806            CDS       T00088                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
cte  Chlorobium tepidum
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:cte00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    CT0806 (recR)
DNA repair and recombination proteins [BR:cte03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      CT0806 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
CyanoBase: 
CYORF: 
UniProt: 
Position
769565..770179
Genome map
AA seq 204 aa AA seqDB search
MRYSSGAVEALIEEFAKLPGIGRKTAQRLTMHVLHERRSEVEKLASALIDVKEKVIRCSV
CQNITDLGVDPCHICTSAGRDRSVICVVESPTEVLAFEKTGHYKGLYHVLHGVISPLDGV
GPDDIKVRELIARIGVDSTGGVREVVLALNPTVEGETTSLYISKLLKPLGINVTRIARGI
PVGAELEFIDEATLSRAMEGRSAI
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgcgttacagctcaggagccgttgaggcgcttatcgaagagttcgcgaagctgcctggc
attgggcgcaagacagcccagcgcctcaccatgcatgtgctgcacgaacggcgctccgag
gtcgagaagttggccagcgcactgatcgacgtcaaggagaaggtgattcgttgctcagtt
tgccagaacattaccgatctcggcgttgatccctgccacatctgcacctctgccgggcgc
gaccgctcggttatctgtgtcgttgaatcacccactgaagtgcttgctttcgagaaaacc
ggccactacaaagggttgtaccacgtgctgcatggcgtgatttcgccgctcgacggcgtc
ggccccgatgacatcaaggtgcgcgaactgatcgctcgcatcggcgtggattcgaccggc
ggcgtgcgcgaagtggtgctcgcgctcaatcccaccgttgagggcgaaacgacatcgctg
tacatcagcaaactgctaaaaccgctcggcatcaacgtcacccgcatcgccagaggcatt
cctgttggcgctgagcttgaatttatcgacgaagcgacgctgtcgcgggcgatggagggg
cgctcggccatctga

DBGET integrated database retrieval system