KEGG   Chlorobium tepidum: CT0911Help
Entry
CT0911            CDS       T00088                                 

Gene name
res
Definition
type III restriction system endonuclease
Orthology
K01156  
type III restriction enzyme [EC:3.1.21.5]
Organism
cte  Chlorobium tepidum
Brite
Enzymes [BR:cte01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.21  Endodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.21.5  type III site-specific deoxyribonuclease
     CT0911 (res)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
CyanoBase: 
CYORF: 
UniProt: 
Position
862683..865658
Genome map
AA seq 991 aa AA seqDB search
MKLHFEPNLDYQLQAIEAVCDLFRGQEICRTEFTVTRQTSLAFAKSDPGVGDLGVGNRLT
LLDDEILANLRDVQIRNGLAPSETLASGDFTVEMETGTGKTYVYLRTIFELNKRYGFTKF
VIVVPSVAIKEGVYKSLQITEEHFKSLYAGVPFDYFLYDSAKLGQVRSFATGANIQIMVV
TVGAINKKDVNNLYKDSEKTGGEKPIDLIRATRPIVIVDEPQSVDGGLQGQGKAALDAMN
PLCTLRYSATHVDKHHMVYRLDAVDAYEKRLVKQIEVASATVEDAHNKPYVRLVSVSNKK
GTISARVELDMQTAGGKVRRQEVTVQDGDNLEQTTGRAMYANCRIGEIRVAKGDEYLELR
VPGGELYLKPGQAWGDVDALAVQREMIRRTIREHLDKEKRLRPQGIKVLSLFFIDEVAKY
RSYDVDGNPVKGDYARIFEEEYRRAANLPGYRTLFQEVDLTRAAEEVHNGYFSIDKKGGW
TDTAENNASNRENAERAYNLIMKEKEKLLSLDTPLKFIFSHSALKEGWDNPNVFQICTLR
DIQTERERRQTIGRGLRLCVNQQGERVRGFEVNTLTVVAMESYEQFAENLQKEIEEDTGI
RFGVVEQHQFAGIPVSQPDGSTVPLGVEQSRALWEHLKTAGYIDDKGKVQDSLKQALKDD
TLVVPEPFAAQRDQIVAGLKKLAGRLEIRNADERRQVRTRQAVLHSPEFKALWERIKYKS
TYRVHFDNKKLIKRCIRAVQEAPAIPKTRLQWRKADIAIGKAGVEATEREGAATVVIDEA
DIELPDLLTELQDRTQLTRRSIQRILSGSGRLKDFKRNPQAFIELTAEAINRCKRLAVVD
GIKYQRLGNEHYYAQELFEQEELTGYLRNLLDANKGVYEQIVYDSDTERTFGDQLEKNDA
IKVYAKLPGWFTVPTPLGSYNPDWAVLVEKDGAERLYFVVETKSGLFAEDLREKERAKIE
CGKAHFKALEVGEAPARFVMARTVDEVLADP
NT seq 2976 nt NT seq  +upstreamnt  +downstreamnt
atgaaactccacttcgaacccaacctcgactaccagctccaggccatcgaggcggtctgc
gacctgttccgcgggcaggagatctgccgcaccgagtttaccgtcacgcggcagacgagc
ctggcgtttgccaagagcgacccgggcgtcggagaccttggcgtcggcaaccgtctgacg
ctgctcgacgacgagattctcgccaacctccgcgacgttcagatccgcaacggccttgcg
ccgtcggagaccctggcctcgggcgacttcaccgtggaaatggagaccggcaccggcaag
acctacgtctacctgcgcacgatcttcgagctgaacaagcgctacggcttcaccaagttc
gttatcgtggtgccgtccgtggccatcaaggagggtgtgtacaagtcgctccagatcacc
gaggagcacttcaagagcctgtacgcgggcgtgcctttcgactacttcctgtacgattcg
gcaaagctcggccaggtgcgtagctttgccaccggagccaacattcagatcatggtggtc
accgtcggggccatcaacaagaaggatgtcaacaacctctacaaggacagcgagaagacc
ggcggcgagaagcccatcgacctgattagggccacccgtcccatcgtcatcgtggacgag
ccgcaaagcgtggacggcggcctccagggccagggcaaggccgcgctcgacgcgatgaac
ccgctctgcacgctgcgctactcggccacccacgtggacaagcaccacatggtttaccgg
ctggacgcggtggatgcctacgagaagcggctggtcaagcagatcgaggtggcctcggcc
acggtggaggacgcgcacaacaagccctacgtgcggctggtttcggtgagcaacaaaaag
ggcacgatcagcgcgcgggtcgagctggacatgcagaccgcgggcggcaaggtgcggcgg
caggaagtcaccgtgcaggacggcgacaacctggagcagaccaccggtcgggcgatgtac
gccaactgccgcatcggcgagatccgcgtggccaagggcgacgagtacctggagctgcgc
gtgcccggcggcgagctgtacctgaagccggggcaggcttggggcgatgtggatgcgctg
gctgtgcagcgcgagatgatccgccgcaccatccgcgagcatctcgacaaggagaagcgc
ctgcggccgcagggcatcaaggtgctgtcgctcttcttcattgacgaggtagcgaagtac
cggtcgtacgacgtcgacggcaacccggtgaagggcgactacgcgcgcatcttcgaggag
gagtaccggcgcgcggcgaacctgcccggctaccgcacgctctttcaggaagtggacctc
acgcgcgccgccgaggaggtgcataacggctacttctccatcgacaagaagggcggctgg
accgacaccgccgaaaacaacgcgagcaatcgcgagaacgccgagcgcgcctacaacctg
atcatgaaggagaaagagaagctgctcagcctcgacacaccgctcaagtttatcttctcc
cactccgcgctcaaggaaggctgggataaccccaacgtcttccagatctgcacgctgcga
gacatccagaccgaacgcgagcggcgccagacgattggccgcggcctgcgcctgtgcgtc
aaccagcagggcgagcgcgtccgcggcttcgaggtcaacacgctcaccgtggtagcgatg
gagagttacgagcagttcgccgagaacctgcagaaggagatcgaagaggacaccggcatc
cgcttcggtgtcgtcgagcagcaccaattcgccggcataccggttagccagcccgacggc
agcacggtgccgcttggcgtggagcagtccagggcgctatgggaacacctcaagaccgcg
gggtacatcgacgacaagggcaaggttcaggattcgctcaagcaggcgctgaaggacgac
acgttggtggtgcccgagccctttgccgcgcaacgcgaccagatcgtggccgggctcaag
aagctcgccgggcggctggagatcaggaacgccgacgagcgccgccaggtgcgcacccgc
caggcggtgctgcacagccccgagttcaaggcgctgtgggagcgcatcaagtacaagagc
acgtatcgggtgcactttgacaacaagaagctgatcaagcgctgtatccgcgcggtgcag
gaggcacccgcgatcccgaaaacgcgcctgcaatggcgcaaggccgacattgccatcggc
aaggcgggcgtggaggcgaccgagcgggaaggcgcggcgacggtggtcatcgacgaagcc
gacatcgaactgcccgacttgcttacggagctgcaggaccgaacgcagctcacgcgccgc
agcatccagcgcatcctgagcggcagcgggcgcctcaaggactttaagcgcaacccgcag
gccttcatcgagctgaccgccgaagccatcaaccggtgcaagcggctggcggtggtggac
ggcatcaagtaccagcgcctgggcaacgagcactactacgcgcaggagctgttcgaacag
gaggagctgaccggctacctcaggaacctgctcgacgccaacaagggcgtttacgagcag
atcgtctacgactcggacacggagcgaacctttggcgaccagcttgaaaagaacgacgcc
atcaaggtgtacgcgaagcttccgggctggttcaccgtgccgacgccgctcggcagctac
aacccggactgggcggtgctggtggagaaggacggggcggagcggctgtacttcgtggtc
gagacgaagagcggtttgttcgccgaagatctgcgggagaaggagcgggccaagatcgag
tgcgggaaggcgcacttcaaagctttggaagtgggagaggcgccggcgcgattcgtcatg
gcgcggacggtggatgaggtgctggcggatccatga

DBGET integrated database retrieval system