KEGG   Chlorobium tepidum: CT1089Help
Entry
CT1089            CDS       T00088                                 

Definition
citrate lyase subunit 1
Orthology
K15231  
ATP-citrate lyase beta-subunit [EC:2.3.3.8]
Organism
cte  Chlorobium tepidum
Pathway
Citrate cycle (TCA cycle)
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Reductive citrate cycle (Arnon-Buchanan cycle)
Anoxygenic photosynthesis in green sulfur bacteria
Brite
KEGG Orthology (KO) [BR:cte00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CT1089
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CT1089
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    CT1089
Enzymes [BR:cte01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.8  ATP citrate synthase
     CT1089
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(1027999..1029195)
Genome map
AA seq 398 aa AA seqDB search
MAKILEGPAMKLFNKWGIPVPNYVVIMDPKRLAQLGEANKWLRESKLVVKAHEAIGGRFK
LGLVKIGLNLDEAIQASREMLGAKVGTAEVRQVIVAEMLDHDAEFYVSIIGNRDGAELLI
SKYGGVDIEDNWDSVRRIQIPLDEHPTIEQLTALAKEAGFEGEIAERVGKICSRLVLCFD
NEDAQSIEINPLVIRKSDMRFAALDAVMNVDWDARFRHADWDFKPVSEIGRPFTEAEQQI
MDIDSRIKGSVKFVEVPGGEIALLTAGGGASVFYADAVVARGGTIANYAEYSGDPPDWAV
EALTETICRLPNIKHIIVGGAIANFTDVKATFSGIINGLRESKSKGYLEGVKIWVRRGGP
NEAQGLAAIRKLQEEGFDIHVYDRSMPMTDIVDLALKS
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atggctaaaattcttgaagggcctgccatgaaattgttcaacaagtggggcattcctgtg
cctaattatgttgttatcatggaccctaaacgtcttgcacagcttggtgaagctaataaa
tggctgcgtgaatcaaaacttgtcgtcaaggctcacgaagcgatcggcggccggttcaag
cttggtcttgtcaaaatcggactcaatctcgatgaggcaatccaggcctccagggagatg
ctcggcgccaaagtcggtacggctgaagtccgccaggtcatcgtggcagaaatgctcgat
catgacgcagaattctatgtctccattatcggcaacagagatggtgccgagttactgatt
tccaaatatggcggtgtcgatatcgaggataactgggacagcgttcgccgcatccagatt
cctctcgatgaacatccgaccatcgagcaactgaccgcgctggccaaagaggccggtttt
gaaggcgaaatcgccgagcgcgtcggcaaaatctgttcccgcctcgttctctgcttcgac
aacgaggacgcacagtctatcgaaatcaacccgctggtcatccgcaagagcgacatgcgt
ttcgctgcgctcgacgccgtgatgaacgtcgattgggacgcccgtttccgtcacgccgac
tgggatttcaagccggtttctgaaattggccgtccgtttaccgaagccgagcagcagatc
atggacatcgactccaggatcaagggttcggtcaagttcgttgaggtgcctggcggtgaa
atcgctcttctgaccgcaggcggaggcgcatcggtgttctatgccgacgcagtcgtggct
cgcggcggcaccatcgccaactatgcagagtattcgggcgacccgcctgactgggccgtg
gaagcgctcaccgaaaccatctgccgtttgcccaatatcaagcacatcatcgtcggtggc
gctatcgccaacttcaccgatgtcaaggcaaccttcagcggtatcatcaacggtttgcgc
gaaagcaagtcgaaaggctacctcgaaggcgtcaaaatctgggtacgccgtggcggtccg
aacgaggctcagggccttgccgccatcaggaagctccaggaggaaggcttcgacattcac
gtctacgaccgctccatgccgatgaccgatattgtcgacctggctctgaagtcttga

DBGET integrated database retrieval system