KEGG   Chlorobium tepidum: CT1296Help
Entry
CT1296            CDS       T00088                                 

Gene name
bchD
Definition
magnesium-chelatase subunit D
Orthology
K03404  
magnesium chelatase subunit D [EC:6.6.1.1]
Organism
cte  Chlorobium tepidum
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cte00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    CT1296 (bchD)
Enzymes [BR:cte01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     CT1296 (bchD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(1216054..1217916)
Genome map
AA seq 620 aa AA seqDB search
MIAFTDIVGMDLAKQALMLLAVDPSLGGVVIPSTVGSGKSTLARAFADILPEGTPFVELP
LNVTEDRLIGGVDLEATLASGQRVVQHGVLSKAHKGVLYVDSLSLLDSSAVSHIMDAMSR
GAVIVEREGLSEVHPADFMLVGTYDPSDGEVRMGLLDRIGIIVPFTPVNDYRARKQIVSL
VMGTRNEEDTQDELRMLRGIIGAAREQLHHVSITNEQIKGLIQTAISLGVEGNRVDIFAI
RAAIANAALNQRTEVDDEDLKLAMKLVLVPRATRMPEREPNPEEMAQDEPPPQEEQPQDE
AEDQNAPPDEADSDADEEQEETPDMIEELMMDAVETELPDNILNISLASKKKAKSGSRGE
ALNNKRGRFVRSQPGEIKSGKVALIPTLISAAPWQASRKAEQAKKGIKSTAALIIGKDDI
KIKRFRDKSGTLFIFMVDASGSMALNRMRQAKGAVASLLQNAYVHRDQVSLISFRGKQAQ
VLLPPSQSVDRAKRELDVLPTGGGTPLASALLTGWETAKQARAKGITQIMFVMITDGRGN
IPLGAAYDPNATKASKEELEKEVEALALSIQADGIASIVVDTQMNYLSRGEAPKLAQKLG
GRYFYLPNAKAEQIVEAALS
NT seq 1863 nt NT seq  +upstreamnt  +downstreamnt
atgatagcatttaccgacattgtaggaatggatctggccaagcaggcgctcatgctcttg
gccgtcgatccctcccttggcggtgtcgtgattccttcgaccgtaggttcgggaaaatcg
acgctcgcaagggcatttgccgacattctgcctgaaggcactccctttgtggagctgccg
ctgaacgtgaccgaagaccgtctcatcggcggcgtcgatctcgaagccacccttgcttca
ggccagcgtgtcgtgcagcacggtgtgctttcaaaggcgcacaagggcgttctctatgtc
gattcgctcagcctgctcgacagctccgccgtgtcgcacatcatggacgccatgagccgt
ggcgcggtgatcgttgagcgcgagggactcagcgaggtgcatccggcggacttcatgctg
gttggcacctacgacccgagtgatggcgaggtgcgcatgggcctgctcgaccgcatcggt
attattgtgccgttcacaccggtgaacgactatcgcgcccgcaagcagattgtcagtctc
gtgatgggcacgcgtaacgaagaggatacgcaggatgaactgcgcatgcttcgcggcatc
atcggcgcggcaagggagcagttgcatcacgtctcgattaccaacgagcagatcaagggt
cttatccagaccgccatcagccttggcgtcgagggcaaccgcgtcgatattttcgcgatc
cgtgctgccatcgccaacgctgcgctcaaccagcgtaccgaggtggacgacgaagatctg
aagctcgccatgaagctggtgctggtgccgagggcgacccgtatgcccgagcgcgaaccc
aaccccgaggagatggcccaggacgagccgccgccgcaggaggagcagccgcaggacgaa
gccgaggatcagaacgcaccgccggacgaggccgactccgatgccgacgaggagcaggag
gagactcccgacatgatcgaggagttgatgatggatgccgttgagaccgaactgcccgac
aacatcctcaacatctcgctcgcttccaagaagaaggcaaaaagcggcagtcgaggcgag
gcgctgaacaacaagcgaggccgcttcgtgcgttcgcagccgggcgaaatcaagagcggc
aaggtcgccttgattccgacgctgatttccgccgcaccgtggcaggcatcgagaaaagcc
gagcaggcaaaaaagggcattaagtctacggctgcactcatcatcggcaaggatgacatc
aagatcaagcgtttccgcgacaagtccggcacgctcttcatcttcatggtggacgcgtcc
ggctcgatggcgctgaaccgcatgcgccaggccaagggcgcggtggcgagcctgttgcag
aacgcttacgtgcatcgcgaccaggtttcgctgatctcgttccgtggcaagcaggcgcag
gtgctcctgccaccatcgcagagcgtggatcgcgccaaacgagagcttgacgtgctgccg
actgggggcggaactccgcttgcctcggccttgcttaccggctgggaaaccgccaagcag
gcgcgcgccaaaggtatcacgcaaatcatgttcgtcatgatcaccgacggtcgcggcaat
attccgctgggtgctgcatacgatcccaacgcgaccaaagcgtccaaggaggagcttgaa
aaagaggtcgaagcattagccctctccatccaggccgatggcatcgcctcgattgtggtc
gatacccagatgaactacttgtcacgaggcgaagcacccaagctcgcgcagaaactcggt
ggccggtacttctaccttcccaacgccaaagctgaacagatcgtcgaagctgcgttgagc
tga

DBGET integrated database retrieval system