KEGG   Chlorobium tepidum: CT1297Help
Entry
CT1297            CDS       T00088                                 

Gene name
bchI
Definition
magnesium-chelatase subunit I
Orthology
K03405  
magnesium chelatase subunit I [EC:6.6.1.1]
Organism
cte  Chlorobium tepidum
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cte00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    CT1297 (bchI)
Enzymes [BR:cte01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     CT1297 (bchI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(1217913..1219091)
Genome map
AA seq 392 aa AA seqDB search
MTQTANAAKKTTSTKASAAKEAKVKVTAEEKAVTEVKKPAAKKKSALAFPFTAIVGQEEM
KLSLILNIIDPRIGGVLVMGHRGTGKSTTVRALAEVLPLIPRVKGDIYNRTVEQYIEMEA
AGKGAPAIKPEDVETELIPVPVVDLPLGATEDRVCGTIDIEKALTSGVKAFEPGLLAQSN
RGFLYIDEVNLLDDHLVDVLLDVAASGKNVVEREGISIRHPARFVLVGSGNPEEGELRPQ
LLDRFGLHARITTINDVAKRVQIVKLRREFDEDPEAFMKKVSREQQKLRKKIVAAQQLLP
QVTMDDAVLTDIAKLCMNLGIDGHRGELTITRTAHAYAAWEGDKKVTMKHVREIAGLCLR
HRLRKDPLETVDAGEKIDRELAKVLGEAEAAA
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgacccagactgccaacgccgcaaaaaaaaccacttcaaccaaggcatcggccgccaag
gaagccaaggtaaaggtaactgcagaagaaaaggctgtgactgaagtcaagaagccggct
gcaaaaaagaaaagtgccctggcatttcccttcactgccattgtcgggcaggaggagatg
aagctcagtctgattctcaatatcatcgatccgaggatcggcggcgttctagttatgggt
catcgcggtaccggcaagagcacgaccgttcgcgcgttggccgaggtgcttccgctcatt
ccgcgcgtcaagggtgatatttacaaccgcaccgtcgaacagtatatcgagatggaggct
gccggaaaaggcgctccggccatcaagcccgaggatgtcgagacagaactgattcccgtg
ccggtggttgaccttccgcttggtgctaccgaagaccgcgtttgcggcaccatcgacatc
gaaaaggcgcttaccagcggcgtcaaggcttttgagcctggtctgcttgcccagtccaac
cgcggtttcctctatatcgacgaggtcaaccttctcgatgaccacctggttgacgtgctg
ctcgacgtggccgccagcggcaagaacgtggttgaacgcgaaggtatcagtatccgccac
cccgcccgtttcgtgctggtcggttcgggcaacccggaagagggcgagcttcgtccgcag
cttctcgaccgtttcggtctccacgcccgcatcaccaccatcaacgacgttgccaagagg
gtgcagatcgtcaagctccgccgtgagttcgacgaggatccggaagccttcatgaagaag
gtctctcgtgagcagcagaaactccggaaaaagatcgtcgccgcccagcagcttcttccg
caggttacgatggacgacgcggtgcttaccgacattgcgaagctttgcatgaacctcggt
atcgacggtcaccgcggcgagttgaccatcacccgtaccgctcacgcctatgccgcctgg
gagggtgacaagaaggtgaccatgaagcacgttcgcgaaatcgccggtctctgccttcgc
caccgccttcgcaaggatccgctcgaaaccgtcgatgcgggagagaagatcgatcgcgaa
ctcgcaaaagtactgggagaggccgaagcagcagcatga

DBGET integrated database retrieval system