KEGG   Chlorobium tepidum: CT1402Help
Entry
CT1402            CDS       T00088                                 

Definition
exodeoxyribonuclease V subunit alpha
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
cte  Chlorobium tepidum
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:cte00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    CT1402
Enzymes [BR:cte01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     CT1402
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
CyanoBase: 
CYORF: 
UniProt: 
Position
1315434..1317638
Genome map
AA seq 734 aa AA seqDB search
MQKPADSHEERLSGSVERVTFHSEESGFTVLRLRVAGQREPVAVVGLATSPAVGEFMECV
GTWQNDRTHGLQFKASKITPAQPTTLEGKERYLASGQVKGLGNFYAKKLIERFGDAVFEV
IENDPERLLEIPGIGRKRLDMVVKSWAEQKAIRDIMLFLQSHGIGTARAWKIYRRYREQA
IATITENPYRLSLDIEGIGFQTADAIATSLGVAKNSLMRAEAGISHVLGELSQNGHCAVP
EETLIDEASRLLQIDHPLVVEAVKNEKLTRRIVGETIDGVPCIFLESLHRAETGVASGLH
RLMRGPLPWNALDPHDALPWIEETTALELSPSQRSAVTLVLASKVSIITGGPGVGKTTIL
KAILSVLQREKVSVALCAPTGRAAKRLTESTGIEAKTIHRLLEFDPQAFDFKRGRGNPLD
ASFVVVDETSMVDVVLMQKLVAAIPDHAAVVFVGDVDQLPSVGPGAVLADMISSEAIPTV
RLTEIFRQAAESMIVVNAHRINQGDMPLTAEGEELSDFYVVKAASAEEIHDKVIQLVTER
IPKRFGLDAVKDVQVLTPMNKGGVGVHALNAELQAKLNPASEPKVTRFGTTFAPGDKVIQ
TVNNYDKEVFNGDIGLIEAIDPEAEIATAFFFDHHRAEYDFNDLDELSLAYATSIHKSQG
SEYPAVVIPLAMQHFTLLERNLIYTAVTRGRKLVVIVAEPKALTLAIKNCKSKRRLTGLV
QRLRESGKQSWQNL
NT seq 2205 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaaacccgccgactcacacgaagagcgcctctccggttcagtcgagcgggtgact
tttcacagcgaggagtcgggcttcacggtgctgcgcctccgggtcgccgggcagcgtgag
ccggttgctgtggtaggcctcgcaacatcaccggcggttggagaattcatggagtgcgtc
ggcacgtggcagaacgaccgcacgcatggattgcagttcaaggcctcgaaaatcaccccc
gcacaacccactacactcgaaggcaaggaacgctacctcgcctccggacaggtgaaggga
ctcggcaatttctacgctaaaaagctgatcgagcgttttggtgacgccgtgttcgaagtg
atcgagaacgatccggagcggctgcttgaaatccccggcatcgggcgcaagcggctcgac
atggtcgtcaaatcgtgggccgagcagaaagcgatccgcgacatcatgctcttcctgcaa
tcgcacggcatcggtacagcgcgggcctggaagatttaccgccgctaccgcgaacaggcc
atcgcaacgatcaccgaaaacccgtaccgcctctcgctcgacatcgaaggcattggcttc
cagaccgccgacgccatcgccacgagcctcggcgtcgcgaaaaattcactgatgcgggcc
gaagcgggcatcagccacgtgctcggcgagctgtcgcagaacggccactgtgcggtgccg
gaagagacgctgattgacgaggcgtcgcgcctgctccagatcgaccatccgctcgtggtc
gaagcggtgaaaaatgaaaagctgacgcgccgcatcgtgggcgaaacgatcgacggcgtg
ccgtgcatcttcctcgaatcgctgcatcgcgccgaaacgggcgtcgcctccggcctgcat
cgcctgatgcgcggcccgctgccgtggaatgcacttgatccgcacgacgcgctgccgtgg
atcgaggagacgacagctctcgaactctcgccatcgcagcgcagcgcagtgacgctcgtg
ctggcgagcaaggtctcgatcatcaccggcgggccgggcgtcggcaaaacgacgatcctc
aaagcaatcctctcggtgctccagcgcgaaaaggtctccgtggcgctctgtgctcccacc
ggacgcgcggccaaacggctcaccgaatcgaccggcatcgaggccaagacgatccaccgc
ctgctcgaattcgacccgcaggcgtttgacttcaagcgcggacgcggcaacccgctcgac
gcctcgttcgtggtggttgacgaaacctcgatggtcgatgtggtgctgatgcagaagctc
gtggcggccatccctgaccacgcggcggtggtcttcgtcggcgacgtcgatcagctccca
tcggtcggtcccggcgcggtgctcgccgatatgatctcgtcggaggcgatcccgaccgtg
cggctcaccgaaatcttccggcaggccgccgagtcgatgatcgtcgtcaacgcccaccgc
atcaaccagggcgacatgccgctcaccgccgagggcgaggagctgtcggatttctacgtg
gtgaaggcggcctcggccgaggagattcacgacaaggtgatacagctcgtcacggagcgc
atcccgaagcgcttcggcctcgatgcggtcaaagacgtgcaggtgctcacgccgatgaac
aaggggggcgtcggcgtgcacgcgctgaacgccgagcttcaggcgaagctcaacccagct
tccgagccgaaggtcacgcgcttcggcaccaccttcgcgccaggcgacaaggtgatccag
acagtcaacaactacgacaaggaggtcttcaacggcgacattggcctcatcgaagcgatc
gacccggaggcggaaatcgcgacagccttcttcttcgaccaccaccgcgccgagtacgat
ttcaacgatctcgacgaactctcgctcgcctacgccacaagcatccacaaaagccagggt
tccgagtacccggctgtcgtcattccgctcgccatgcagcacttcacgctgctcgaacgc
aacctcatctacacggcggtcacgcgcggacgcaagctcgtggtgatcgttgccgagccg
aaagcgctcacactcgccatcaaaaactgcaagtcaaagcgccgcctgaccgggctcgtg
cagcggctcagagagtccgggaaacaaagctggcaaaatttgtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system