KEGG   Chlorobaculum tepidum: CT1428Help
Entry
CT1428            CDS       T00088                                 

Gene name
hemD
Definition
uroporphyrinogen-III synthase
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
cte  Chlorobaculum tepidum
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:cte00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
CyanoBase: 
CYORF: 
UniProt: 
Position
1340786..1341526
Genome map
AA seq 246 aa AA seqDB search
MKTVLVTRPKHQAEPFVRELAQYGLDSVVFPTIEIRPVTGWSVPDLTRFAGIFFTSPNSV
QFFLERLLEESPDELPNLQQARVWAVGKTTGGDLEKHGVSIEPLPKSADAVSLMSGIDAS
EIEGKTFLFVRGSLSLGTIPEVIAKRGGICVELTVYDNIQPSLEETQKIKSLLTEGKIDC
LSFTSPSTAINFFEAIDSKEVPSDVLIAAIGTTTSSALEKLGVKVDIIPEYFDGPNFAKA
IAAALS
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaccgttctcgttacacgcccgaagcatcaggccgagccttttgtgagggaactt
gcgcagtacggcctggactcggttgtctttccaacgatcgagatcaggccggttaccggc
tggagcgttcctgatctcaccagattcgccggtatcttctttaccagccccaacagcgtc
cagttctttctcgaacgcttgcttgaagagtctcccgacgaactgccaaatcttcagcag
gcccgcgtctgggcggtcggcaaaaccactggtggcgatctggagaaacatggcgtctca
atcgagcctcttccgaagagcgctgacgccgtcagcctcatgtctggcatcgacgccagc
gaaatcgaaggcaaaaccttcctctttgttcggggtagcctctcgctcggcaccattccc
gaagtcatcgccaaacgcggcggcatctgcgtcgagctgaccgtttacgacaatattcag
ccttcactcgaagagacccagaaaatcaaatcactgctcacagaaggcaaaatcgactgc
ctctcgttcaccagtccgtcaactgccatcaacttctttgaagccatagactcaaaggaa
gtgccgagcgacgtactcatcgccgccatcggcaccaccacctccagcgcactcgaaaag
ctgggtgtcaaggtggacatcatccccgaatacttcgacggccccaacttcgccaaagcc
atcgccgctgccctcagctga

DBGET integrated database retrieval system