KEGG   Chlorobium tepidum: CT1444Help
Entry
CT1444            CDS       T00088                                 

Gene name
tpiA
Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
cte  Chlorobium tepidum
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:cte00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CT1444 (tpiA)
   01230 Biosynthesis of amino acids
    CT1444 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CT1444 (tpiA)
   00051 Fructose and mannose metabolism
    CT1444 (tpiA)
   00562 Inositol phosphate metabolism
    CT1444 (tpiA)
Enzymes [BR:cte01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     CT1444 (tpiA)
Exosome [BR:cte04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   CT1444 (tpiA)
  Exosomal proteins of bladder cancer cells
   CT1444 (tpiA)
  Exosomal proteins of melanoma cells
   CT1444 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(1356164..1356901)
Genome map
AA seq 245 aa AA seqDB search
MVGNWKMNNTIAESVDLATAIAEKVGADGVQCEVGIAPTFPALYEVCKVIEWSGIRLCAQ
NCHYESDGPFTGEVSTRMLAAAGCSYVILGHSERRQLFGETNATVNLKVKKALAEGLSVI
LCVGETLDERERGVTGQIVTAQVVEGLIDVTDISKLVIAYEPVWAIGTGKTATKEQAQEV
HALIRAKVTELYGQKAADHLRIQYGGSVKPSNAAELFAMPDIDGGLIGGASLNADDFMAI
VEAAG
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
gtggtgggcaactggaagatgaacaacaccatcgccgagtctgtcgatctggcaactgcg
attgccgagaaggtcggagctgacggtgtgcagtgtgaagtgggcatcgcccccacattt
ccggcgttgtacgaggtttgcaaggtgatcgagtggagcggaatcaggctctgcgctcag
aactgtcattacgagagtgatggcccattcaccggcgaggtctccacgcggatgcttgcc
gctgccggatgcagctatgttatcctcgggcactcggagcgccgtcaactgttcggcgaa
accaatgccacggtcaacctcaaggtcaaaaaggcgttggctgaagggttgagcgtcatc
ctctgcgttggtgagacgctcgacgagcgcgagcgcggcgtgacgggtcagatcgtcact
gcccaagtggttgaggggctgattgatgttaccgacatcagcaagctggtgattgcctac
gaaccggtatgggcaatcggcaccggcaaaaccgccaccaaagagcaggcgcaggaggtt
cacgcgctgattcgggcgaaagtcaccgaactctacggtcagaaagcggcggaccatctc
aggatccagtacggcggcagcgtcaaaccctctaacgctgcggagcttttcgccatgccg
gatatcgacggtggcctgattggtggcgcgagcctcaatgccgacgacttcatggcgatt
gtcgaggcggcggggtaa

DBGET integrated database retrieval system