KEGG   Chlorobaculum tepidum: CT1444Help
Entry
CT1444            CDS       T00088                                 

Gene name
tpiA
Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
cte  Chlorobaculum tepidum
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Gluconeogenesis, oxaloacetate => fructose-6P
Class
Metabolism; Overview; Carbon metabolism [PATH:cte01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:cte01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:cte00010]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:cte00051]
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:cte00562]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(1356164..1356901)
Genome map
AA seq 245 aa AA seqDB search
MVGNWKMNNTIAESVDLATAIAEKVGADGVQCEVGIAPTFPALYEVCKVIEWSGIRLCAQ
NCHYESDGPFTGEVSTRMLAAAGCSYVILGHSERRQLFGETNATVNLKVKKALAEGLSVI
LCVGETLDERERGVTGQIVTAQVVEGLIDVTDISKLVIAYEPVWAIGTGKTATKEQAQEV
HALIRAKVTELYGQKAADHLRIQYGGSVKPSNAAELFAMPDIDGGLIGGASLNADDFMAI
VEAAG
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
gtggtgggcaactggaagatgaacaacaccatcgccgagtctgtcgatctggcaactgcg
attgccgagaaggtcggagctgacggtgtgcagtgtgaagtgggcatcgcccccacattt
ccggcgttgtacgaggtttgcaaggtgatcgagtggagcggaatcaggctctgcgctcag
aactgtcattacgagagtgatggcccattcaccggcgaggtctccacgcggatgcttgcc
gctgccggatgcagctatgttatcctcgggcactcggagcgccgtcaactgttcggcgaa
accaatgccacggtcaacctcaaggtcaaaaaggcgttggctgaagggttgagcgtcatc
ctctgcgttggtgagacgctcgacgagcgcgagcgcggcgtgacgggtcagatcgtcact
gcccaagtggttgaggggctgattgatgttaccgacatcagcaagctggtgattgcctac
gaaccggtatgggcaatcggcaccggcaaaaccgccaccaaagagcaggcgcaggaggtt
cacgcgctgattcgggcgaaagtcaccgaactctacggtcagaaagcggcggaccatctc
aggatccagtacggcggcagcgtcaaaccctctaacgctgcggagcttttcgccatgccg
gatatcgacggtggcctgattggtggcgcgagcctcaatgccgacgacttcatggcgatt
gtcgaggcggcggggtaa

DBGET integrated database retrieval system