KEGG   Chlorobaculum tepidum: CT1495Help
Entry
CT1495            CDS       T00088                                 

Gene name
ispE
Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
cte  Chlorobaculum tepidum
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
C5 isoprenoid biosynthesis, non-mevalonate pathway
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:cte00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(1399308..1400168)
Genome map
AA seq 286 aa AA seqDB search
MKHFSVKACAKINLGLLITSRRADGYHTLETIFAPIDWFDTLEFTESDAISMECSNLDLL
VDDSNLCIRAAKALQEHTGVKRGATIKLLKRVPFGAGLGGGSSDAAATLNALCKLWQIDV
PSAELHKLAVKLGADVPYFLEMKGLAYAAGIGEELEDLNLALPWHVVTVFPEVQVPTAWA
YKNFHRQFERPVPDLKTLVRRLCHERDISVFGVFENDFASVVFEHYPVVREVRDALAASG
AQFVSLSGSGSAVYALYEGRADAVKAAEAMSARFRINMTPAGFRME
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
atgaagcacttttcggtcaaagcctgcgccaaaatcaacctcggtctgctcatcaccagc
cgtcgggctgatggctatcacactcttgaaacaatcttcgcgccgatcgactggttcgat
acccttgaattcaccgagtctgacgccatctcgatggagtgcagcaatcttgatctgctg
gttgatgactcgaatctctgcatccgcgctgccaaagcgttgcaggagcacaccggggtg
aaacgcggggcgactatcaaactgctcaagcgggtgccatttggcgcgggtctcggtggt
gggagcagcgatgcggcggcgacgctcaacgcgctgtgcaagctctggcagatcgacgtg
ccctcggcggagctgcacaaactcgccgtcaagcttggcgcggacgtgccctatttcctc
gaaatgaagggacttgcctacgctgccggaatcggcgaggagctcgaagacctcaatctt
gccctgccctggcacgtagtaacggtcttccctgaggtgcaggtgccgactgcctgggcc
tacaagaatttccaccgccagttcgagcgtccggtgcccgatctgaaaactctcgttcgt
cggctctgccacgagagagacatctcggtgttcggtgttttcgagaatgatttcgcctcg
gtggtgttcgagcactatccggtggttcgcgaggttcgcgacgcgctcgcggcctctggc
gcccagttcgtctcgctctccggcagcggctctgcggtctatgccctttatgaagggcgt
gccgacgcggtcaaggccgccgaagcgatgagcgctcgcttccgtatcaacatgactccg
gcaggtttccggatggagtga

DBGET integrated database retrieval system