KEGG   Chlorobaculum tepidum: CT1603Help
Entry
CT1603            CDS       T00088                                 

Gene name
pfk-1
Definition
phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
cte  Chlorobaculum tepidum
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Class
Metabolism; Overview; Carbon metabolism [PATH:cte01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:cte01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:cte00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:cte00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:cte00051]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:cte00052]
Metabolism; Energy metabolism; Methane metabolism [PATH:cte00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
CyanoBase: 
CYORF: 
UniProt: 
Position
1510727..1511932
Genome map
AA seq 401 aa AA seqDB search
MKKIGILTSGGDCGGLNAVIKGAALMALNKGLELYVIPNGYAGLYNLLNQDRLVRLDEAR
LDQFQASFAGSEAGHSRVKIKAISNPDKYNRIKVGMKKFDLDALIISGGDDSGSVMIDLN
HNGIQCIHCPKTMDLDLQTYSVGGDSTINRIAQFVEDLKTTGRTHNRVLVTEVFGRYAGH
TAFRSGVAAEADCILIPEIPVDWDVVYEHIVERFTRRIRQSDVHSGTYTIVVAEGMKNAD
GTDIVDESAGIDAFGHKKLAGAGKYVCQEIKKRFKTDPRMPQFMKDTGMFVEGIYEIPEV
REVHPGHLVRAGHSSAYDINFGFEAGAAAVLLLLEGKTGVTISKVKGRKIEYIEASKAIE
QRYVDLDQVAMYESIGTCFGRTPAAYEPILREVDGVYERIY
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaaaaatcggaattcttaccagcggtggcgactgcggcggcctgaacgccgtcatc
aagggtgccgcactcatggccctgaacaaggggcttgaactgtatgtgatccccaacggc
tacgccggactgtacaacctcctgaatcaggaccggttggtcaggctcgacgaggcccgt
ctcgaccagttccaggccagcttcgccggctcggaagccggccactcgcgggtgaaaatc
aaggcgatcagcaaccccgacaaatacaaccgcatcaaggtcggcatgaaaaagttcgat
ctcgacgcgctcatcatcagcggcggcgacgactccggcagcgtcatgatcgacctgaac
cacaacggcatccagtgcatccactgtccaaagacgatggatcttgacttgcagacctac
tcggtcggcggtgactcgaccatcaaccgcatcgcccagttcgtcgaggatctgaagacg
acaggacgtacccacaaccgcgtgctggtcacggaggtgttcggacgctacgcgggccac
acggccttccgcagcggcgtggctgccgaagccgactgcatcctgattccggaaatcccg
gttgactgggatgtcgtgtacgagcacatcgtcgaacgcttcacccgccgcatccggcag
agcgacgtgcacagcggcacctataccatcgtggtcgccgagggcatgaagaacgccgac
ggcacggacatcgtcgatgagtcggcaggcatcgatgcatttggccacaaaaagctcgcg
ggcgcgggcaagtatgtttgccaggagatcaagaagcgcttcaagaccgacccgcgaatg
ccgcagttcatgaaggataccggcatgttcgtcgagggcatctacgaaattccggaggtg
cgcgaagtccatccgggccacttggtgcgcgccgggcactcctcggcctacgacatcaac
ttcggcttcgaggctggcgcagcagcggtattgctcctgcttgaaggcaaaaccggtgtg
acgatctccaaggtcaaggggcgcaaaatcgagtacatcgaagcctcaaaggcgatcgaa
cagcgctatgtcgatctcgaccaggttgccatgtacgaatcgatcggcacctgtttcggc
agaactccggcagcctacgagccgatcctgcgagaagttgacggcgtgtacgaaaggatt
tattga

DBGET integrated database retrieval system