KEGG   Chlorobium tepidum: CT1603Help
Entry
CT1603            CDS       T00088                                 

Gene name
pfk-1
Definition
phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
cte  Chlorobium tepidum
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:cte00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CT1603 (pfk-1)
   01230 Biosynthesis of amino acids
    CT1603 (pfk-1)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CT1603 (pfk-1)
   00030 Pentose phosphate pathway
    CT1603 (pfk-1)
   00051 Fructose and mannose metabolism
    CT1603 (pfk-1)
   00052 Galactose metabolism
    CT1603 (pfk-1)
  Energy metabolism
   00680 Methane metabolism
    CT1603 (pfk-1)
Enzymes [BR:cte01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     CT1603 (pfk-1)
Protein phosphatases and associated proteins [BR:cte01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     CT1603 (pfk-1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
CyanoBase: 
CYORF: 
UniProt: 
Position
1510727..1511932
Genome map
AA seq 401 aa AA seqDB search
MKKIGILTSGGDCGGLNAVIKGAALMALNKGLELYVIPNGYAGLYNLLNQDRLVRLDEAR
LDQFQASFAGSEAGHSRVKIKAISNPDKYNRIKVGMKKFDLDALIISGGDDSGSVMIDLN
HNGIQCIHCPKTMDLDLQTYSVGGDSTINRIAQFVEDLKTTGRTHNRVLVTEVFGRYAGH
TAFRSGVAAEADCILIPEIPVDWDVVYEHIVERFTRRIRQSDVHSGTYTIVVAEGMKNAD
GTDIVDESAGIDAFGHKKLAGAGKYVCQEIKKRFKTDPRMPQFMKDTGMFVEGIYEIPEV
REVHPGHLVRAGHSSAYDINFGFEAGAAAVLLLLEGKTGVTISKVKGRKIEYIEASKAIE
QRYVDLDQVAMYESIGTCFGRTPAAYEPILREVDGVYERIY
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaaaaatcggaattcttaccagcggtggcgactgcggcggcctgaacgccgtcatc
aagggtgccgcactcatggccctgaacaaggggcttgaactgtatgtgatccccaacggc
tacgccggactgtacaacctcctgaatcaggaccggttggtcaggctcgacgaggcccgt
ctcgaccagttccaggccagcttcgccggctcggaagccggccactcgcgggtgaaaatc
aaggcgatcagcaaccccgacaaatacaaccgcatcaaggtcggcatgaaaaagttcgat
ctcgacgcgctcatcatcagcggcggcgacgactccggcagcgtcatgatcgacctgaac
cacaacggcatccagtgcatccactgtccaaagacgatggatcttgacttgcagacctac
tcggtcggcggtgactcgaccatcaaccgcatcgcccagttcgtcgaggatctgaagacg
acaggacgtacccacaaccgcgtgctggtcacggaggtgttcggacgctacgcgggccac
acggccttccgcagcggcgtggctgccgaagccgactgcatcctgattccggaaatcccg
gttgactgggatgtcgtgtacgagcacatcgtcgaacgcttcacccgccgcatccggcag
agcgacgtgcacagcggcacctataccatcgtggtcgccgagggcatgaagaacgccgac
ggcacggacatcgtcgatgagtcggcaggcatcgatgcatttggccacaaaaagctcgcg
ggcgcgggcaagtatgtttgccaggagatcaagaagcgcttcaagaccgacccgcgaatg
ccgcagttcatgaaggataccggcatgttcgtcgagggcatctacgaaattccggaggtg
cgcgaagtccatccgggccacttggtgcgcgccgggcactcctcggcctacgacatcaac
ttcggcttcgaggctggcgcagcagcggtattgctcctgcttgaaggcaaaaccggtgtg
acgatctccaaggtcaaggggcgcaaaatcgagtacatcgaagcctcaaaggcgatcgaa
cagcgctatgtcgatctcgaccaggttgccatgtacgaatcgatcggcacctgtttcggc
agaactccggcagcctacgagccgatcctgcgagaagttgacggcgtgtacgaaaggatt
tattga

DBGET integrated database retrieval system