KEGG   Chlorobaculum tepidum: CT1671Help
Entry
CT1671            CDS       T00088                                 

Gene name
trpC
Definition
indole-3-glycerol phosphate synthase
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
cte  Chlorobaculum tepidum
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:cte01230]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:cte00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(1581845..1582615)
Genome map
AA seq 256 aa AA seqDB search
MTYLTRILETKAREVAELKKLKPERRYREACGDLPATRDFRSAITSRDGGINLIAEVKKA
SPSRGVLVEDFRPLDIAARYAELGASAFSVLTDSHYFQGSPDYLKAITQQFSIPVLRKEF
IIDESQIYETRLMGADAALLIVAALEPSQLRDYLQLFAELGLHALVEVHDRRELDIAIEQ
GSTIVGVNNRDLRDFTVDLMTSVNLKREYPEGVLSVAESGLKRRDDVLLMQDAGFDAVLI
GEGLLASEELRQFSWG
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgacctatcttacccggattctcgagaccaaggcaagagaggttgccgaactgaaaaag
ctgaaaccggagcgccgctatcgtgaggcgtgcggcgatcttccggcgacgcgcgatttc
cgctcggccattacgagccgtgacggcggcatcaatctcatcgctgaagtaaaaaaggca
tcgccctcgcgcggcgtgctcgtcgaggattttcgtccgcttgacatcgctgcgcgctac
gccgaacttggcgcgtcggccttctccgtccttaccgactcccactactttcaggggtcg
ccagactacttgaaggcgatcacgcagcagttctccattcctgtgctccgcaaggagttc
attatcgacgagagccagatttacgaaacccgcctcatgggcgcggatgcggcgctcctc
atcgtggcggcgctcgaaccgtcgcaactccgcgactacctccagcttttcgctgaactt
ggcctgcacgcgctggtcgaagtgcacgatcgccgtgaacttgatattgccatcgagcag
ggttctacgattgtcggggtcaacaaccgcgatctgcgcgacttcaccgtcgatctcatg
acctcggttaacctgaagcgggagtatcctgaaggcgtgctctccgtcgctgaaagcggc
ctgaaacgccgcgacgatgtgctgctcatgcaggacgccggctttgacgctgtgctcatc
ggcgagggtttgctggcaagcgaggagttgaggcagttctcgtggggttag

DBGET integrated database retrieval system