KEGG   Chlorobium tepidum: CT1671Help
Entry
CT1671            CDS       T00088                                 

Gene name
trpC
Definition
(RefSeq) indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
cte  Chlorobium tepidum
Pathway
cte00400  Phenylalanine, tyrosine and tryptophan biosynthesis
cte01100  Metabolic pathways
cte01110  Biosynthesis of secondary metabolites
cte01130  Biosynthesis of antibiotics
cte01230  Biosynthesis of amino acids
Module
cte_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cte00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CT1671 (trpC)
Enzymes [BR:cte01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     CT1671 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS
Motif
Other DBs
NCBI-GeneID: 1006764
NCBI-ProteinID: NP_662554
CyanoBase: CT1671
CYORF: CT1671
UniProt: Q8KBW1
Position
complement(1581845..1582615)
Genome map
AA seq 256 aa AA seqDB search
MTYLTRILETKAREVAELKKLKPERRYREACGDLPATRDFRSAITSRDGGINLIAEVKKA
SPSRGVLVEDFRPLDIAARYAELGASAFSVLTDSHYFQGSPDYLKAITQQFSIPVLRKEF
IIDESQIYETRLMGADAALLIVAALEPSQLRDYLQLFAELGLHALVEVHDRRELDIAIEQ
GSTIVGVNNRDLRDFTVDLMTSVNLKREYPEGVLSVAESGLKRRDDVLLMQDAGFDAVLI
GEGLLASEELRQFSWG
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgacctatcttacccggattctcgagaccaaggcaagagaggttgccgaactgaaaaag
ctgaaaccggagcgccgctatcgtgaggcgtgcggcgatcttccggcgacgcgcgatttc
cgctcggccattacgagccgtgacggcggcatcaatctcatcgctgaagtaaaaaaggca
tcgccctcgcgcggcgtgctcgtcgaggattttcgtccgcttgacatcgctgcgcgctac
gccgaacttggcgcgtcggccttctccgtccttaccgactcccactactttcaggggtcg
ccagactacttgaaggcgatcacgcagcagttctccattcctgtgctccgcaaggagttc
attatcgacgagagccagatttacgaaacccgcctcatgggcgcggatgcggcgctcctc
atcgtggcggcgctcgaaccgtcgcaactccgcgactacctccagcttttcgctgaactt
ggcctgcacgcgctggtcgaagtgcacgatcgccgtgaacttgatattgccatcgagcag
ggttctacgattgtcggggtcaacaaccgcgatctgcgcgacttcaccgtcgatctcatg
acctcggttaacctgaagcgggagtatcctgaaggcgtgctctccgtcgctgaaagcggc
ctgaaacgccgcgacgatgtgctgctcatgcaggacgccggctttgacgctgtgctcatc
ggcgagggtttgctggcaagcgaggagttgaggcagttctcgtggggttag

DBGET integrated database retrieval system