KEGG   Chlorobium tepidum: CT1706Help
Entry
CT1706            CDS       T00088                                 

Gene name
folP
Definition
dihydropteroate pyrophosphorylase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
cte  Chlorobium tepidum
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cte00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    CT1706 (folP)
Enzymes [BR:cte01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     CT1706 (folP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
1615877..1616791
Genome map
AA seq 304 aa AA seqDB search
MMKQNLGDQSRYRLNCAGAMLDLSARPAIMGIVNLTPDSFFDGGSYGSAGEAVQLERALE
SAMAMARAGAEIIDVGGESTRPGSAPVSAEEEIRRTIPFIELLRRQSDVLISIDTWKSEV
AAKALRAGVNIVNDISGFSFDPKMPGVCARHHCGVVLMHTPAKPDALRWSYNTSAETEEV
MNRVTTFLSRSIAIAREHGIESIIVDPGLGFGKTVEENYRLLARLDELHKLGCPVLAGIS
RKSFLGQAIRRTGEETPPPSERLLATISANTIALMNGADILRVHDVDAAIQARAVVLATR
RASD
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
gtgatgaaacagaatcttggggatcaaagccgttaccgtctgaactgcgctggtgcaatg
ctcgacctctcggcgcgtccggccatcatgggcatcgtcaacctcacccccgattcgttc
ttcgacggcggcagctacggcagcgccggagaggcggtacagctcgaacgcgccctcgaa
tcggcgatggcgatggcgcgggcaggcgcggagatcatcgacgtgggcggcgaatcgacc
cgccctggctcggcaccggtcagcgcagaggaggagatacggcgaaccattcccttcatc
gagcttttacgaaggcagagcgatgtgctgatctctattgacacctggaagtcagaagtt
gccgccaaagcgctgcgggccggagtgaacatcgtcaacgacatttcaggcttcagcttc
gatccgaaaatgccgggggtgtgcgcccgccaccactgtggcgtggtactgatgcacacg
cccgctaaaccggacgcgctccgctggagttataacaccagcgcagagacggaagaggtg
atgaaccgcgtgaccactttcctgagccgttcgatagctatcgccagagaacacggcatc
gagtcaatcatcgtcgatcccggcctcggcttcggcaaaaccgtcgaggagaactaccga
ctgctcgcgcggctcgacgagctgcacaaactcggctgcccggtgctcgccggaatatcg
cgaaagtcgtttctcggccaggcgatcaggcgcaccggcgaggagacgccaccgccgtcg
gaacggctcctggccaccatcagcgccaacaccatcgcgctcatgaacggcgcagatatc
ctgcgcgtgcacgacgtcgatgccgccatccaggctcgcgccgttgtgctcgcaacccgc
cgcgcttcggactga

DBGET integrated database retrieval system