KEGG   Chlorobaculum tepidum: CT1706Help
Entry
CT1706            CDS       T00088                                 

Gene name
folP
Definition
dihydropteroate pyrophosphorylase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
cte  Chlorobaculum tepidum
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:cte00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
CyanoBase: 
CYORF: 
UniProt: 
Position
1615877..1616791
Genome map
AA seq 304 aa AA seqDB search
MMKQNLGDQSRYRLNCAGAMLDLSARPAIMGIVNLTPDSFFDGGSYGSAGEAVQLERALE
SAMAMARAGAEIIDVGGESTRPGSAPVSAEEEIRRTIPFIELLRRQSDVLISIDTWKSEV
AAKALRAGVNIVNDISGFSFDPKMPGVCARHHCGVVLMHTPAKPDALRWSYNTSAETEEV
MNRVTTFLSRSIAIAREHGIESIIVDPGLGFGKTVEENYRLLARLDELHKLGCPVLAGIS
RKSFLGQAIRRTGEETPPPSERLLATISANTIALMNGADILRVHDVDAAIQARAVVLATR
RASD
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
gtgatgaaacagaatcttggggatcaaagccgttaccgtctgaactgcgctggtgcaatg
ctcgacctctcggcgcgtccggccatcatgggcatcgtcaacctcacccccgattcgttc
ttcgacggcggcagctacggcagcgccggagaggcggtacagctcgaacgcgccctcgaa
tcggcgatggcgatggcgcgggcaggcgcggagatcatcgacgtgggcggcgaatcgacc
cgccctggctcggcaccggtcagcgcagaggaggagatacggcgaaccattcccttcatc
gagcttttacgaaggcagagcgatgtgctgatctctattgacacctggaagtcagaagtt
gccgccaaagcgctgcgggccggagtgaacatcgtcaacgacatttcaggcttcagcttc
gatccgaaaatgccgggggtgtgcgcccgccaccactgtggcgtggtactgatgcacacg
cccgctaaaccggacgcgctccgctggagttataacaccagcgcagagacggaagaggtg
atgaaccgcgtgaccactttcctgagccgttcgatagctatcgccagagaacacggcatc
gagtcaatcatcgtcgatcccggcctcggcttcggcaaaaccgtcgaggagaactaccga
ctgctcgcgcggctcgacgagctgcacaaactcggctgcccggtgctcgccggaatatcg
cgaaagtcgtttctcggccaggcgatcaggcgcaccggcgaggagacgccaccgccgtcg
gaacggctcctggccaccatcagcgccaacaccatcgcgctcatgaacggcgcagatatc
ctgcgcgtgcacgacgtcgatgccgccatccaggctcgcgccgttgtgctcgcaacccgc
cgcgcttcggactga

DBGET integrated database retrieval system