KEGG   Chlorobaculum tepidum: CT1800Help
Entry
CT1800            CDS       T00088                                 

Gene name
pyrB
Definition
(RefSeq) aspartate carbamoyltransferase
  KO
K00609  aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
cte  Chlorobaculum tepidum
Pathway
cte00240  Pyrimidine metabolism
cte00250  Alanine, aspartate and glutamate metabolism
cte01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cte00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    CT1800 (pyrB)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    CT1800 (pyrB)
Enzymes [BR:cte01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     CT1800 (pyrB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace_N OTCace
Motif
Other DBs
NCBI-GeneID: 1008170
NCBI-ProteinID: NP_662679
CyanoBase: CT1800
CYORF: CT1800
UniProt: Q8KBI7
Position
1704506..1705432
Genome map
AA seq 308 aa AA seqDB search
MNHLTGLFGLPASTLVELLDLATGYREGLNREPETFAPLLSNRRIALVFFENSTRTRFSF
ELAARHLGAGTLSFTAASSSVSKGETLSDTIRNLEAMKVDAFVLRHPSSGAAEFVASITK
RPVINAGDGTHEHPTQALLDLLTLREYFGKIEGLKIMILGDILHSRVARSNIIGLKTLGA
EIAVCAPTTLLPGRIDQLGVRVFTGIDEALAWADAAIVLRLQLERATGGYIPSLEEYSAS
YGLTDEKLDRLKRLMPVLHPGPINREIEISNLVADRIQPPGYSSSMLMEQVTNGVAVRMA
VLHRLLAK
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
ttgaaccacctcacgggacttttcggattaccggcaagcacgctggtcgaactgctcgac
cttgccaccggttacagggaggggctcaaccgagagcctgaaaccttcgccccgctgctc
tcgaaccgtcgaatcgcccttgttttcttcgagaattccacccgcacccgcttttcgttc
gagctcgccgcacggcacctcggcgcggggacactgagcttcacggcggcgtcgagcagc
gtcagcaaaggcgaaacgctctcggacaccatccggaacctcgaagcgatgaaggttgat
gccttcgttttgcgccacccgtcgtcgggcgcggcggagttcgtagcctcgatcaccaag
cggcccgtcatcaacgccggagacggcacgcacgagcatccgacgcaggccttgctcgac
ctcctcaccctccgcgaatatttcggaaagatcgagggcctgaagatcatgatcctcggc
gacattctgcacagccgcgttgcgcggtcgaacatcatcggcctgaaaacgcttggcgcg
gaaatcgccgtctgcgcccccacgacgcttctgccgggccgcatcgaccagctcggcgtg
cgggtcttcaccggcatcgacgaggcgctcgcctgggccgacgcggccatcgtgctgcgg
cttcagctcgaacgcgccaccggaggctacattccgtcgctcgaagagtattcggcctcg
tacggcctgaccgacgaaaagctcgaccgcctgaaacggctgatgccggtgctccatccg
gggccgatcaaccgcgaaatcgaaatctcgaacctggtggccgaccgcatccagccacct
ggctattcaagcagtatgctgatggagcaggtgaccaacggcgtggccgtgcgcatggcc
gtgctgcaccggctgctggccaagtga

DBGET integrated database retrieval system