KEGG   Chlorobaculum tepidum: CT1931Help
Entry
CT1931            CDS       T00088                                 

Definition
dihydroflavonol 4-reductase
Orthology
K00091  
dihydroflavonol-4-reductase [EC:1.1.1.219]
Organism
cte  Chlorobaculum tepidum
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(1825618..1826619)
Genome map
AA seq 333 aa AA seqDB search
MSGIPILITGATGYIGARLLVDMIARYGDSVRCRVTVREGSDASFLRNLPVEIAQADMHD
PIAVNEAVKGAEVVFHCAGLIAYTRNFRNRLYDTNVLGTRHIVDACLEAGVKRLVATSSI
AAVGSSDAKSGIRESNEQTPFTEWQRHNVYMESKYLAELECRRGVAEGLDVVMVNPGVVI
GKNSEPGMSGSSSNEVLRMIYEGRLPLCPDGATGFVDVRDVADAHIAAWQKGKAGERYII
VGENLSFRELFERIAALPGSRSGKVFRVNRVARMLAGVGGELFSLLTKRPSFISIESLRQ
AAHLSRYSNQRSVRELGMSYRPFEETLRSAIMQ
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgtcaggtataccgattctcatcaccggtgcaaccggctacataggggcacggcttctc
gtcgatatgatcgcacggtacggcgactccgtccgctgccgggtcaccgttcgggaggga
tcggacgcatcgtttctccgcaatttgccggtcgagatcgcccaggctgacatgcacgat
ccgatcgctgtcaacgaggcggtcaaaggtgcggaggtcgtcttccactgcgcaggtctg
atcgcctacaccagaaatttccgcaaccggctttacgataccaatgtgctcggcacccgc
cacattgtcgatgcctgtctggaggcgggcgtaaagcggttggtcgccaccagctcgatt
gccgccgtcggttcgtccgacgcgaagagtggtattcgggagtcgaacgagcagaccccc
ttcaccgagtggcagcgtcacaacgtgtacatggagtccaagtatctggccgagctcgaa
tgccgccgcggcgtggccgaagggcttgacgtggtgatggtcaatccaggcgtggtgatc
ggcaagaattccgagccggggatgtctggcagcagttccaacgaggtgctccggatgatc
tacgagggccgcctgccgctttgccccgatggcgcgacaggattcgtcgatgtgcgcgac
gtggccgacgcccatatcgccgcatggcagaagggaaaagcgggagagcgctacatcatc
gttggcgagaatctctctttcagagagcttttcgagcggatcgccgcgctgcccggcagc
cggagcggcaaggtgtttcgtgttaaccgagttgccaggatgctggctggcgtcggcggt
gaactcttttcgcttctgacgaaacggccatcgttcatcagcatcgagagtctcaggcag
gctgcgcatttgtcccgctacagcaaccagcgttcggtgcgcgagctaggcatgtcgtac
cgcccattcgaggagacgcttcgaagcgctattatgcagtaa

DBGET integrated database retrieval system