KEGG   Chlorobaculum tepidum: CT1955Help
Entry
CT1955            CDS       T00088                                 

Definition
(RefSeq) magnesium-chelatase, bacteriochlorophyll c-specific subunit
  KO
K03403  magnesium chelatase subunit H [EC:6.6.1.1]
Organism
cte  Chlorobaculum tepidum
Pathway
cte00860  Porphyrin and chlorophyll metabolism
cte01100  Metabolic pathways
cte01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cte00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    CT1955
Enzymes [BR:cte01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     CT1955
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CobN-Mg_chel DUF3479 Fzo_mitofusin E1_FCCH PAS_3 Swi3
Motif
Other DBs
NCBI-GeneID: 1008221
NCBI-ProteinID: NP_662832
CyanoBase: CT1955
CYORF: CT1955
UniProt: H2VFJ5
Position
1846264..1850151
Genome map
AA seq 1295 aa AA seqDB search
MFLACYIKAGFITLRGLKNLNQSTSQLFMGDKIRIAAVVGMEQCNQRVWREVKDLIGQNA
ELTQWTDQDLEHQNPEAGKAIREADCIFTTLIQFKNQADWLREQIDQSKVRTIFAYESMP
EVMQMTKVGNYVVSEDGSGMPDIVKKVAKMLVKGRDEDALYGYMKLLKIMRTMLPLIPKK
AKDFKNWMQVYTYWMHPTAENLASMFNYIMAEYFDVNVKADKVQEVPTMGFYHPDAPEYM
KDLNHYEKWLHKKSRDAKSRNNIAMLFFRKHLLQEKEYIDNTIRAIEAKGLNPLPVFVMG
VEGHVAAREWFTHTKIDMLINMMGFGFVGGPAGATTPGASAAAREEILGKLNAPYVVSQP
LFIQDINSWKTQGVVPLQSAMTYALPEMDGAVCPVVLGAIKDGRLHTVPDRLDRLSTLAK
KFSELRHTANRDKKVAFVVYDYPPGMGRKASAALLDVPKSIYKMLQRLQNEGYNVGELPE
SPEALLAMLDRATDYEIQAHEPDCFAIDRATFNAITTERERERIEARWGGFPGEIAPVGV
DKMFLGGLTLGNVFIGVQPRLGIQGDPMRLLFDKENTPHHQYIAFYRWISREFGAHALVH
VGMHGTVEWMPGLQLGVTGDCWPDALLGEVPHFYIYPVNNPSEANIAKRRGYATMISHNI
PPLSRAGLYKELPAFKEMLNDYRERGLEKIVDVETEMAIIEKAENLNLADDCPRLEGEPF
SDYISRLYIYLLELETKLISNTLHVFGETPELATQVTTISEYLKVRGNERSLPSVIMQAI
GESETWGDYAALATKARKGDPKALKVREKVDDITRNFIEQTIFGNANASNVFSVLTGGAK
ANEEMAAAINSALQEGVALKQGLQDNSHEMESFVRALNGEYLPSGPGGDLVRDGASVLPT
GRNIHAIDPWRIPSELAFKRGKQIADTIIQKHRDENNGEYPETIAQVLWGLDTIKSKGEA
VAVIIALIGAEPAYDAQNKISHYRLVPLEKLGRPRIDVLIQISSIFRDTFGVLVDHLDKL
VKDAAKAIEPAEMNHIKKHVDEALAQGKDFESATSRLFTQAPGTYGSQIDELVEDSAWES
EEDLDNMFIKRTAFAYGGNRYGDEQSDILKNLLGTVDRVVQQVDSAEYGISDIDRYFSSS
GALQLSARRRNPKGDNVKLNYVETYTADIKVDDAEKALKVEFRTKLLNPKWFEGMLAQGH
SGATEISNRFTYMLGWDAVTKGVDDWVYKEAAETYAFDPAMRDKLMKLNPKAFKNIVGRM
LEASGRGMWSADPDTIEKLQEIYSDLEDRLEGIEV
NT seq 3888 nt NT seq  +upstreamnt  +downstreamnt
atgtttttagcctgttatatcaaagcgggatttattacattacgtggcctgaaaaacctc
aatcaaagcacatctcagttatttatgggcgacaaaatccgaattgccgcggtggtcgga
atggaacagtgcaaccagcgcgtatggagagaagtgaaagatttgatcggccagaacgcc
gagctgactcagtggaccgatcaggatctcgaacaccagaacccggaggccggtaaggcg
atccgcgaagccgactgcatcttcaccaccctgatacagttcaagaatcaggcagactgg
cttcgggagcagatcgatcagtcgaaggtcaggacgatcttcgcctacgagtcgatgccc
gaagtgatgcagatgaccaaagtcggcaactacgtcgtttccgaagacggtagcgggatg
cccgacatcgtcaagaaagtcgccaaaatgctcgtcaaaggccgcgatgaggacgccctc
tacggctatatgaagcttctgaagatcatgcgcaccatgctgccgctgatcccgaagaag
gctaaggatttcaaaaactggatgcaggtttacacctactggatgcatccgaccgccgaa
aatctcgcctcgatgttcaattacatcatggcggagtatttcgacgtaaacgtgaaggca
gacaaggttcaggaggtaccgaccatgggattttaccatcccgatgcgccggaatacatg
aaagacctgaaccactacgaaaagtggctgcataaaaagagtcgcgacgccaaatcccgc
aacaatatcgcaatgctcttcttccgcaaacacctcttgcaggagaaagagtatatcgac
aacaccatccgcgccatcgaggccaagggactgaatcccctaccggtgttcgtgatgggc
gtcgagggccacgtggccgcgcgcgagtggttcacccacaccaagattgacatgctcatc
aacatgatgggcttcggcttcgtcggtggacctgccggcgcaaccacgccgggcgcttcg
gctgccgcgcgcgaggagattctcggcaagctcaacgcgccgtacgtcgtctcccagccg
ctcttcatccaggacatcaactcgtggaaaacgcagggcgtcgtgccgttgcagtcggcc
atgacctacgcccttccggagatggacggcgcagtctgccccgtcgttctcggcgcgatc
aaggatggccgcctgcacaccgtgcctgaccgcctcgaccgtctttccacgcttgcaaaa
aaattctctgaactgcgccacaccgcaaaccgcgacaagaaggtcgctttcgtggtctac
gactatccgcccggcatgggccgcaaagccagcgctgcactgctcgacgtgccaaagagc
atctacaagatgttgcagcgcctccagaacgagggctacaacgtcggcgaactgccggag
tccccggaagcgctgctcgccatgctcgaccgcgccaccgattacgaaatccaggcgcac
gagccggactgcttcgccatcgaccgcgcgaccttcaacgccatcaccaccgagcgcgag
cgcgaacgcatcgaggctcgctggggcggcttccccggcgaaatcgccccggtcggcgtg
gacaagatgttcctcggcgggctcacgctcggcaacgtcttcatcggcgtccagccgcgc
ctcggcatccagggcgacccgatgcgcctgctcttcgacaaggagaacacgccgcaccac
caatacatcgccttctaccgctggatcagccgcgagttcggcgcgcacgcccttgtgcac
gtcggtatgcacggcacggtcgagtggatgcccggccttcagctcggcgtcaccggcgac
tgctggcccgacgcactgctcggcgaggtgccgcacttctacatctatccggtcaacaac
ccgagcgaggccaacatcgctaagcgccgcggttacgcgaccatgatttcgcacaacatt
ccaccgctctcccgcgccggtctgtacaaggagcttccggccttcaaggagatgctcaac
gactaccgcgagcgcggccttgaaaaaatcgtcgatgtcgaaaccgagatggccatcatc
gaaaaggctgaaaacctcaatctggccgacgactgcccaaggcttgaaggcgaaccgttc
agcgactacatcagccgcctgtacatctacctgctcgaactcgaaaccaagctcatctcc
aacacgctgcatgtgttcggggaaacgccggaactcgcgacccaggtcaccacgatctcc
gagtacctcaaggttcgcggcaacgagcgctcactgccttcggttatcatgcaggcgatc
ggtgaaagcgaaacctggggcgactatgccgcactggccaccaaagcccgcaaaggcgat
ccaaaggcgctcaaggtgagagaaaaagttgacgacatcacccgtaactttatcgaacag
accatcttcggtaatgcgaatgccagtaacgtcttcagcgtgctgaccggaggcgcgaaa
gccaacgaagagatggctgcggcgatcaactccgccttgcaggagggcgtggctctcaag
cagggactccaggacaacagccacgagatggagagcttcgtgcgcgctctgaacggcgag
tacctcccctccggccccggcggcgacctggtgcgcgacggcgcttcggtgttgccgacc
ggccgcaacattcacgccatcgacccgtggagaattccctcggagctggccttcaaacgc
ggcaagcagatcgccgacaccatcatccagaaacatcgcgacgagaacaacggcgagtat
cccgaaactatcgcgcaggtgctctggggtctggacaccatcaagagcaagggcgaagcg
gtcgcggtcatcattgcgctcataggcgcggaaccagcctacgacgcgcagaacaaaatc
agccactaccggctcgtaccgctcgaaaagctcggacgcccgagaatcgacgtcctgatc
cagatcagctcgatcttccgcgacaccttcggcgtcttggtcgatcacctcgacaaactg
gtcaaggacgccgccaaggccatcgaacccgccgagatgaaccacatcaagaagcatgtc
gatgaggcgcttgcccagggcaaggactttgaaagtgccacctcgcgcctcttcacccag
gctccaggcacttacggatcgcagatcgacgagctggtcgaagactccgcctgggagtcc
gaagaggatcttgacaacatgttcatcaagcgcaccgcctttgcctacggcggcaaccgc
tacggcgacgagcagtcggacattctcaagaatctgctcggcaccgtcgatcgcgtcgtg
cagcaggtggactcggcggagtacggtatttccgacattgaccgctacttctcctcgtcg
ggcgcgcttcagctttcagctcgccgccgcaacccgaaaggcgacaacgtcaagctgaac
tatgtcgaaacctacacggcggacatcaaggttgacgatgccgagaaggcgctcaaggtt
gagttccgcaccaagctgctcaacccgaaatggttcgagggtatgcttgcgcagggccac
agcggcgcaaccgaaatcagcaaccgcttcacctacatgctcggctgggacgccgtcacc
aagggcgttgacgactgggtgtacaaggaggctgccgaaacctacgccttcgatccggcc
atgcgcgacaagctgatgaagcttaatccgaaagctttcaaaaacatcgttggcagaatg
ctcgaagcgagtggccgcggcatgtggtcagccgatcccgacaccatcgaaaagcttcag
gagatctactccgatctggaagatcgcctcgaaggcatcgaggtctga

DBGET integrated database retrieval system