KEGG   Chlorobium tepidum: CT2035Help
Entry
CT2035            CDS       T00088                                 

Gene name
thrC
Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
cte  Chlorobium tepidum
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:cte00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    CT2035 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CT2035 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    CT2035 (thrC)
Enzymes [BR:cte01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     CT2035 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
CyanoBase: 
CYORF: 
UniProt: 
Position
1933548..1934873
Genome map
AA seq 441 aa AA seqDB search
MIFYSTTKASAPVTMKKATLEGLAPDGGLYVPSTMPHFSAEEIALLENGSFNNIAFAVAK
KFAGDEIPLDRLSELIDECFTFDTPLHELDPDTFVEELFHGPTLAFKDYGARFLARMTGY
FAAEESRLITVLVATSGDTGSAVAYGFHGIPNTRVVLLYPSGKVSRLQEQQLTTAGDNVF
ALEVKGDFDDCQRLVKQAFVDQSLRQKLTLTSANSINISRLIPQSFYYAWAALQLRQRKP
DALPIFSVPSGNYGNLTAGVMAKMMGFPIGHFIAASNANDSVTRYLDEGRYEPKPTVRTL
TTAMDVGNPSNFARLRYFFENDFRKMGQEITGIAVSDAETLETIRSVYEKYGYVMDPHTA
VGYRALDRFRQDHAGAGTPGVVLSTAHPVKFDEAIKEATGNEVPLPETMEEIMSKPKKAT
LIGNRYEELARFLSELNTQTN
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atgatcttctacagcacgacgaaagcgtctgctcccgtcacgatgaaaaaagccaccctc
gaagggctcgcacccgatggagggttgtatgttccatcgacgatgccgcacttctccgcc
gaagagattgcccttctggagaacggctcgttcaacaatattgcctttgccgtcgccaag
aagttcgccggtgacgaaatcccgctcgaccgcctctcggaactgatcgacgagtgcttt
accttcgacacgccgctgcacgaacttgacccggacaccttcgtcgaggagctgttccac
ggtccgacgctcgcattcaaggactacggcgcccgatttctcgcgcggatgaccggctat
ttcgccgccgaagagagccgcctcatcacggtgctggtcgccacgtcgggcgacaccggc
agcgctgtggcctacggcttccacggcattccgaacacccgcgtggtgctgctctatccg
tcgggcaaggtgagccgccttcaggagcagcagctcaccacggcaggcgacaacgtcttc
gcgctcgaagtgaaaggcgatttcgacgactgccagcgcctcgtcaagcaggccttcgtc
gaccaatcgctgcgtcagaagctgacgctcacttcggcaaactccatcaacatctcgcgc
ctgattccgcagtcgttctactatgcctgggcggcgctccagctccgccagcgcaagcca
gacgctctgccgatcttctcagtaccaagcggcaactacggcaacctgacggcgggcgtc
atggcaaagatgatgggctttccgatcggccacttcatcgccgcctcgaacgccaacgac
agcgtcacccgctatctcgacgaggggcgctacgagccgaaaccgaccgtccggacgctg
accacggcgatggatgtgggcaacccgagcaacttcgcgaggctgcgctatttcttcgaa
aacgatttccggaaaatgggccaagagatcaccggcatcgcggtctcggatgcagaaacc
ctcgaaacgatccgctcggtttacgagaaatacggctatgtcatggatccgcacaccgcc
gtcggctaccgggcgctcgaccggttccgtcaggatcatgccggagcgggcaccccgggc
gtcgtgctttcgaccgctcacccggtcaaattcgacgaggcgatcaaagaggcaaccggc
aatgaggtgccacttccggaaacgatggaagaaatcatgagcaagccgaaaaaagccacg
ctgatcggcaaccgctacgaagagctggctcgctttctctcggagctcaacacccagaca
aactga

DBGET integrated database retrieval system