KEGG   Chlorobaculum tepidum: CT2035Help
Entry
CT2035            CDS       T00088                                 

Gene name
thrC
Definition
(RefSeq) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
cte  Chlorobaculum tepidum
Pathway
cte00260  Glycine, serine and threonine metabolism
cte00750  Vitamin B6 metabolism
cte01100  Metabolic pathways
cte01110  Biosynthesis of secondary metabolites
cte01120  Microbial metabolism in diverse environments
cte01230  Biosynthesis of amino acids
Module
cte_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:cte00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CT2035 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    CT2035 (thrC)
Enzymes [BR:cte01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     CT2035 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP Thr_synth_N Thr_dehydrat_C
Motif
Other DBs
NCBI-GeneID: 1007525
NCBI-ProteinID: NP_662910
CyanoBase: CT2035
CYORF: CT2035
UniProt: Q8KAW6
Position
1933548..1934873
Genome map
AA seq 441 aa AA seqDB search
MIFYSTTKASAPVTMKKATLEGLAPDGGLYVPSTMPHFSAEEIALLENGSFNNIAFAVAK
KFAGDEIPLDRLSELIDECFTFDTPLHELDPDTFVEELFHGPTLAFKDYGARFLARMTGY
FAAEESRLITVLVATSGDTGSAVAYGFHGIPNTRVVLLYPSGKVSRLQEQQLTTAGDNVF
ALEVKGDFDDCQRLVKQAFVDQSLRQKLTLTSANSINISRLIPQSFYYAWAALQLRQRKP
DALPIFSVPSGNYGNLTAGVMAKMMGFPIGHFIAASNANDSVTRYLDEGRYEPKPTVRTL
TTAMDVGNPSNFARLRYFFENDFRKMGQEITGIAVSDAETLETIRSVYEKYGYVMDPHTA
VGYRALDRFRQDHAGAGTPGVVLSTAHPVKFDEAIKEATGNEVPLPETMEEIMSKPKKAT
LIGNRYEELARFLSELNTQTN
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atgatcttctacagcacgacgaaagcgtctgctcccgtcacgatgaaaaaagccaccctc
gaagggctcgcacccgatggagggttgtatgttccatcgacgatgccgcacttctccgcc
gaagagattgcccttctggagaacggctcgttcaacaatattgcctttgccgtcgccaag
aagttcgccggtgacgaaatcccgctcgaccgcctctcggaactgatcgacgagtgcttt
accttcgacacgccgctgcacgaacttgacccggacaccttcgtcgaggagctgttccac
ggtccgacgctcgcattcaaggactacggcgcccgatttctcgcgcggatgaccggctat
ttcgccgccgaagagagccgcctcatcacggtgctggtcgccacgtcgggcgacaccggc
agcgctgtggcctacggcttccacggcattccgaacacccgcgtggtgctgctctatccg
tcgggcaaggtgagccgccttcaggagcagcagctcaccacggcaggcgacaacgtcttc
gcgctcgaagtgaaaggcgatttcgacgactgccagcgcctcgtcaagcaggccttcgtc
gaccaatcgctgcgtcagaagctgacgctcacttcggcaaactccatcaacatctcgcgc
ctgattccgcagtcgttctactatgcctgggcggcgctccagctccgccagcgcaagcca
gacgctctgccgatcttctcagtaccaagcggcaactacggcaacctgacggcgggcgtc
atggcaaagatgatgggctttccgatcggccacttcatcgccgcctcgaacgccaacgac
agcgtcacccgctatctcgacgaggggcgctacgagccgaaaccgaccgtccggacgctg
accacggcgatggatgtgggcaacccgagcaacttcgcgaggctgcgctatttcttcgaa
aacgatttccggaaaatgggccaagagatcaccggcatcgcggtctcggatgcagaaacc
ctcgaaacgatccgctcggtttacgagaaatacggctatgtcatggatccgcacaccgcc
gtcggctaccgggcgctcgaccggttccgtcaggatcatgccggagcgggcaccccgggc
gtcgtgctttcgaccgctcacccggtcaaattcgacgaggcgatcaaagaggcaaccggc
aatgaggtgccacttccggaaacgatggaagaaatcatgagcaagccgaaaaaagccacg
ctgatcggcaaccgctacgaagagctggctcgctttctctcggagctcaacacccagaca
aactga

DBGET integrated database retrieval system