KEGG   Chlorobaculum tepidum: CT2238Help
Entry
CT2238            CDS       T00088                                 

Definition
siroheme synthase
Orthology
K13542  
uroporphyrinogen III methyltransferase / synthase [EC:2.1.1.107 4.2.1.75]
Organism
cte  Chlorobaculum tepidum
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:cte00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(2101209..2102594)
Genome map
AA seq 461 aa AA seqDB search
MTGSIHTEPQAAAKRGYVYIAGAGPGDPELLTLKADRVLRGADVILFDDLVLPQMLEPYK
AEKIYTGKRKDAHHFAQDEINQEIVRHALMGKTVVRLKGGDPFIFGRGGEEIETLRQHGI
GYEIIPGITAAHGASAYSEIPLTMRKVSSSVAFCTGHPVNSIQVPDTDTIVYYMVASNVH
DVLDKVAASGRSGETMVAVVQNATRYNQRVITSTLDEFRKREKAVYSPALLIIGQNISQY
IEENWFSRKKKVLMTGEAPKKYPPADYITVPFPCQQVAGADLGAVKACIEGIDRFSMLFF
QNRFAVRYFFKYLFEHGRDVRHLAHLVICTANRSVASALQEYGIIPDCCLDREGVDAIAA
MLRKEELTGQRILLSGAEHVDELVAGQLREGGNEVTPLVVYVHGAQDQVEKIDLDFIDEI
YFASADCVKKFRGMYDAIPARIAVTPADERTAEEMRRQFGG
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atgaccggttcaatccatacagagccgcaggccgcggcaaagagaggctacgtctatatc
gcgggcgcggggccgggtgatccggagctgctcacgctcaaggctgatcgggtgctgcgc
ggggcggacgtgattctcttcgacgatctcgtgctgccccagatgcttgaaccctacaag
gccgagaagatctataccggcaagcgcaaggatgcgcatcacttcgcgcaggacgaaatc
aaccaggagatcgtgcgccatgcgctcatgggcaagaccgtcgtgaggctcaagggcggc
gatcccttcatctttggacgcggcggcgaggagatcgagacgctgcgccagcacggcatc
ggttacgagatcattcccggcatcaccgcagcgcacggagctagcgcctacagtgaaatt
ccgctcaccatgcgcaaggtctcctcgtcggtcgccttctgcaccggccatccggtcaac
agcatccaggtgcccgataccgacacgatcgtctattacatggtggcctcgaacgtgcac
gacgtgctcgacaaggtggcggcgtcggggcggagcggcgagacgatggtcgccgtggtt
cagaacgccacgcgctataaccagcgcgtcattaccagcacgctcgacgagttccgcaag
cgcgaaaaggcggtttactcaccggcgttgcttatcatcggccagaacatcagccagtac
atcgaagagaactggttctcccgcaagaagaaggtgctcatgaccggcgaagcgccgaaa
aaatacccgcctgccgactacatcaccgtgcccttcccgtgccaacaggtggcgggcgcg
gatctcggcgcggtgaaagcctgcatcgaggggatcgaccggttctcgatgctctttttc
cagaaccgcttcgccgtccggtatttctttaaatatctcttcgaacatggccgcgacgtg
aggcatctggcgcatctcgtcatctgcaccgcgaaccgttcggtcgcctcggcgttgcag
gagtacggcatcattcccgactgctgccttgaccgggagggcgtggatgcgatcgccgcg
atgctgcgcaaggaggaactcaccggccagcgcattcttctgtcgggcgcggagcatgtc
gatgagctggtggccgggcaactccgtgaggggggcaacgaggtcacgccgctcgtcgtt
tacgtgcatggcgcgcaggatcaggtcgagaagatcgacctcgacttcatcgacgaaatc
tacttcgcctcggcagattgcgtgaaaaaattcagagggatgtacgacgcgattcccgcc
cgaatcgccgtcaccccggcggacgagcgcaccgcagaggagatgcggcgtcagtttggc
ggatag

DBGET integrated database retrieval system