KEGG   Chlorobaculum tepidum: CT2271Help
Entry
CT2271            CDS       T00088                                 

Definition
(RefSeq) lysophospholipase L2
  KO
K03928  carboxylesterase [EC:3.1.1.1]
Organism
cte  Chlorobaculum tepidum
Brite
Enzymes [BR:cte01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     CT2271
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hydrolase_4 Abhydrolase_6 Abhydrolase_1 Esterase DLH Ser_hydrolase LIDHydrolase GST_N_2 PGAP1 Thioesterase
Motif
Other DBs
NCBI-GeneID: 1007288
NCBI-ProteinID: NP_663143
CyanoBase: CT2271
CYORF: CT2271
UniProt: Q8KA96
Position
complement(2138352..2139149)
Genome map
AA seq 265 aa AA seqDB search
MTNRVTNGQPERLLTGVLILHGFTANLESVRALFGPLGRFDLKMATPLLRGHGAASPDEL
RGVTWREWLDDAENAFETLTGTGGKAVVIGHSMGALLALQLAARRPELVDSVILATPPVR
LTSPLGPGRPLHFLAPLVSHVVDRWDMEARFADPGSAIIPKQYDWAPTKTILSMFELLEE
TMRITGRVRVPALILQARHESVVLPESAEILTRAIATPPEAKSIVWFDKTDHQIFCDCER
KAAVDAVVSFVSKRFPAATNQSVKA
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgacgaatcgggtgacaaacgggcagccggagaggcttttgactggcgtcctgatcctt
cacgggtttacggccaatcttgagagcgtcagggcgctgttcggcccgcttggccggttt
gatctcaagatggccacgccgctgttgcgcggtcatggcgcggcttcgccggacgagctg
cgcggcgtgacctggagagagtggctcgatgatgccgagaacgcgttcgaaacgctgacc
ggcaccggcggcaaggcggtggtgatcgggcacagcatgggtgcgctgcttgcgctgcaa
cttgccgcgcgccgtccggagctggtcgattcggtcattctcgccacgccgccggtcagg
ctgacctcgccgctcggccccggacgcccgctccacttcctcgcgccgctcgtcagccat
gttgtcgatcgctgggatatggaggccagatttgccgaccccggcagcgccattattcca
aaacagtatgactgggcaccgaccaaaacgattctctcgatgttcgagctgctggaagag
acaatgcggattaccggtcgcgtccgcgttcccgcgctgattctgcaagcccgccacgaa
agcgtcgtgctgcccgagagcgccgaaattctgacgcgcgcaatcgcaacgccgccggag
gcaaagtccatcgtctggttcgacaaaaccgatcaccagattttctgcgactgtgaacgc
aaggctgccgttgatgctgttgtcagctttgtctccaaacgttttcccgctgcaaccaat
caatcagtaaaagcatga

DBGET integrated database retrieval system