KEGG   Chlorobium tepidum: CT2271Help
Entry
CT2271            CDS       T00088                                 

Definition
lysophospholipase L2
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
cte  Chlorobium tepidum
Brite
Enzymes [BR:cte01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     CT2271
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(2138352..2139149)
Genome map
AA seq 265 aa AA seqDB search
MTNRVTNGQPERLLTGVLILHGFTANLESVRALFGPLGRFDLKMATPLLRGHGAASPDEL
RGVTWREWLDDAENAFETLTGTGGKAVVIGHSMGALLALQLAARRPELVDSVILATPPVR
LTSPLGPGRPLHFLAPLVSHVVDRWDMEARFADPGSAIIPKQYDWAPTKTILSMFELLEE
TMRITGRVRVPALILQARHESVVLPESAEILTRAIATPPEAKSIVWFDKTDHQIFCDCER
KAAVDAVVSFVSKRFPAATNQSVKA
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgacgaatcgggtgacaaacgggcagccggagaggcttttgactggcgtcctgatcctt
cacgggtttacggccaatcttgagagcgtcagggcgctgttcggcccgcttggccggttt
gatctcaagatggccacgccgctgttgcgcggtcatggcgcggcttcgccggacgagctg
cgcggcgtgacctggagagagtggctcgatgatgccgagaacgcgttcgaaacgctgacc
ggcaccggcggcaaggcggtggtgatcgggcacagcatgggtgcgctgcttgcgctgcaa
cttgccgcgcgccgtccggagctggtcgattcggtcattctcgccacgccgccggtcagg
ctgacctcgccgctcggccccggacgcccgctccacttcctcgcgccgctcgtcagccat
gttgtcgatcgctgggatatggaggccagatttgccgaccccggcagcgccattattcca
aaacagtatgactgggcaccgaccaaaacgattctctcgatgttcgagctgctggaagag
acaatgcggattaccggtcgcgtccgcgttcccgcgctgattctgcaagcccgccacgaa
agcgtcgtgctgcccgagagcgccgaaattctgacgcgcgcaatcgcaacgccgccggag
gcaaagtccatcgtctggttcgacaaaaccgatcaccagattttctgcgactgtgaacgc
aaggctgccgttgatgctgttgtcagctttgtctccaaacgttttcccgctgcaaccaat
caatcagtaaaagcatga

DBGET integrated database retrieval system