KEGG   Candida tenuis: CANTEDRAFT_112817Help
Entry
CANTEDRAFT_112817 CDS       T03099                                 

Definition
(RefSeq) ferredoxin reductase-like protein
  KO
K00326  cytochrome-b5 reductase [EC:1.6.2.2]
Organism
cten  Candida tenuis
Pathway
cten00520  Amino sugar and nucleotide sugar metabolism
Brite
KEGG Orthology (KO) [BR:cten00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    CANTEDRAFT_112817
Enzymes [BR:cten01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.2  cytochrome-b5 reductase
     CANTEDRAFT_112817
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_6 NAD_binding_1 NAD_binding_6
Motif
Other DBs
NCBI-GeneID: 18246691
NCBI-ProteinID: XP_006684516
JGI: Cante1_112817
UniProt: G3AYV9
Position
Unknown
AA seq 304 aa AA seqDB search
MEDKRDLLKQPLHGIYIPIALMIVGTLMLDVSYMPYTIAFIVIMCSINFYSAWSRRCSID
PVKWTELEMIDRTVISKNSAIYRFQLKHQDEVLDIPTGHHLACVFMVDGKDEVRYYSPIS
NKYDAGFFDILVKSYPNGKVSSRFPNLREGQTVKFRGPVGRLEYKTNMAKEIGLIAGGSG
ITPILQVITEVITTPADTTKISLIYANNTLNDILLRDEIDELSKNYPNFKVHYTLTEPPA
NWEGSTGFVSKEMITKYLPKPSEENRLFICGPPEMKKSLIEISQELGWDKTSMKSDPNDQ
VFCF
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atggaagataaaagagatttattgaaacaaccacttcatgggatttatattcccattgcg
ttgatgatcgttggtactttgatgctcgatgtttcatacatgccctacaccattgcattt
attgtcatcatgtgtagtatcaacttttactctgcttggagtagaagatgttctattgat
cctgttaaatggactgaattagaaatgattgacagaactgtcatctccaaaaactcggcc
atctacagattccaattgaagcaccaagatgaagtattggacatccctaccggacatcat
ttggcttgtgttttcatggttgatggtaaagatgaagttagatactattccccaatttcc
aacaagtatgatgccgggttctttgatattttggtgaagtcttatcccaatggtaaggta
tcatccagatttcctaacttacgtgaaggtcaaactgttaaatttagaggaccggttgga
agattggaatacaaaacaaacatggctaaagagattgggttgattgcaggaggttccgga
atcactcctatcttacaagtgatcactgaggtgattaccactcccgctgataccaccaaa
atctccttgatttacgccaataacactcttaatgatattttgttgagagatgaaattgat
gaattgagtaaaaactatccgaattttaaagttcactacacgttaacagaacctccagct
aactgggaaggtagcactgggtttgtttccaaggaaatgatcaccaagtacttgcctaaa
ccttccgaagaaaacagattgtttatctgtggacctccagaaatgaaaaaatctttgatc
gaaatatctcaggaattaggttgggacaagacatccatgaagtctgatcctaatgatcaa
gttttctgcttctag

DBGET integrated database retrieval system