KEGG   Candida tenuis: CANTEDRAFT_113516Help
Entry
CANTEDRAFT_113516 CDS       T03099                                 

Definition
NADH-cytochrome b-5 reductase
Orthology
K00326  
cytochrome-b5 reductase [EC:1.6.2.2]
Organism
cten  Candida tenuis
Pathway
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cten00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    CANTEDRAFT_113516
Enzymes [BR:cten01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.2  cytochrome-b5 reductase
     CANTEDRAFT_113516
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 285 aa AA seqDB search
MSADSEPNPLVVFATIAAIISSFIALYFIKQRNKNQPVLDKTQFKKFPLIEKTRISHNTC
VYRFGLPKSTDRLGLPIGQHISIGTTINGKEVVRSYTPISTDDQTGYFDLLIKVYEQGNI
TKHIDSKKIGETIDVRGPKGFFTYTPNMVKSFGMIAGGTGITPMYQIMSAILKNPQDTTK
IHLVYANVTENDILMKAELEQMKAQHPDQLFIHYVLNTAPENWEGSVGFVTPEIMEQYLP
KSTDDTNLLLCGPPPMLSAMKKAAMTLGYPKAKPVSKLGDQVFVF
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atgtctgctgattcggaacccaacccattggtggtatttgccaccatcgcagccataatt
tctagtttcattgctctttatttcatcaaacagcggaataaaaatcaacccgtgttagat
aaaacacagttcaaaaagttcccattgattgaaaaaacaagaataagtcacaatacttgt
gtctatagattcggattgcccaagtcgaccgacagattgggcttgccaattggccagcat
atttccattggaaccaccattaatggtaaggaggtggttcggtcgtatactccaatctcc
accgatgaccaaactggatactttgatttattgatcaaagtgtacgaacaaggaaacatc
accaagcacatcgactccaaaaagatcggtgaaaccatcgacgttagaggacccaaaggt
ttcttcacctacacgccaaacatggtgaagagttttggaatgattgctggtggtactgga
attactcccatgtaccaaatcatgtctgcgattttgaagaatcctcaagacaccaccaaa
atccacttggtttacgccaacgtcactgaaaacgacattttgatgaaagcagaattggaa
caaatgaaagcccagcacccagaccaattattcatccactacgtgttaaacactgctcct
gaaaactgggaaggctcagtagggtttgtcactcctgaaatcatggaacaatacttgcct
aaatccactgatgatacaaacttgttgttgtgtggtccccctccaatgctcagtgccatg
aagaaggccgctatgactttgggttaccccaaggccaaacctgtcagcaagctcggagat
caagtatttgtattttag

DBGET integrated database retrieval system