KEGG   Candida tenuis: CANTEDRAFT_114492Help
Entry
CANTEDRAFT_114492 CDS       T03099                                 

Definition
alkaline phosphatase-like protein
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
cten  Candida tenuis
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:cten00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    CANTEDRAFT_114492
Enzymes [BR:cten01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     CANTEDRAFT_114492
Exosome [BR:cten04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CANTEDRAFT_114492
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 547 aa AA seqDB search
MFDTKPLLGEEAPSVYNTTHRRKTVYAVLKAVAVAILVVSALVYSGSSSHKPAPNKKNII
FMVTDGMGPASLSLARSFKQFRDDLPINDILALDRHLIGSSRTRSSSSLVTDSAAGATAF
SCGLKSYNGAIGVDPSKNPCGTILEALKLQGYLTGLVVTTRITDATPAAFSSHVDYRFQE
DLIAEQQLGEYPLGRMVDLIIGGGRCHFLPASVDGGCRADSRNLIKEYTENDIWSYVGNR
QQFDELDGGKNVTLPLLGLLATSDIPYDIDRNPKQYPSLAEQVKVALTALSKATEDSDKG
FFLLIEGSRIDHAGHHNDPSAQVREVLAYDEAYKEVLKFIEDSDVETVAVSTSDHETGGL
VTSRQVSPSYPDYIWYPEVLLNCSHSGEFLTSKIVSFTRSNSDAKVVEDFITKEIFQNDM
GIQDATAQEVKDVKENLSTPGQLLYVLNNMISLRSQTGWTTHGHSAVDVNIYGAVSNFGS
IKTQLYQSAENVGLLGNHENIEIGKFMESVAGVDLSKITELLKDTKHHPSSVDEINANSF
DQYHQTQ
NT seq 1644 nt NT seq  +upstreamnt  +downstreamnt
atgtttgacactaaacccttgctcggagaagaagctccttccgtatataatacaacccac
cggaggaagaccgtgtatgctgtcctcaaggcggtagcggtggccattttggttgtttcg
gcgttggtgtactcaggaagctcgagccataagccagctcccaataagaagaacatcata
ttcatggtgaccgatggaatgggccctgcgtcgctctctttggcccggtctttcaagcag
ttcagagacgacttgcccatcaacgatattttggctttggacagacatttgatagggtcg
tccagaactcgctctagttcgtcattggtcacagactcagccgctggcgccactgctttc
tcctgtggactcaagtcgtacaacggggccatcggcgtcgaccccagcaaaaatccctgt
ggaaccattttagaggcgttgaaattacaagggtatttgacaggattggtggtcaccacc
agaattaccgatgccacacctgccgcctttagttctcatgtggactatcgtttccaagaa
gacttgatcgccgaacaacaattgggcgaatatccattgggaagaatggtggatttgatt
attggaggtggcagatgccactttttaccagcgtctgtggacggaggatgccgtgctgac
tcgagaaacttgatcaaggagtacactgaaaacgacatttggtcgtacgtgggaaaccgg
caacagtttgacgagttggacggcgggaaaaatgttactttgccgttgttgggcttattg
gctacttctgatattccttacgacattgacagaaaccctaaacaatatccttccttggcc
gaacaagtcaaggtggcgttaacagccttgtccaaggccaccgaagactctgacaagggg
ttctttttgttgattgaaggctctcgtattgatcatgctggtcatcacaacgatcctctg
gctcaggtgagagaagttttagcttatgacgaagcgtacaaggaagtattgaagttcatc
gaagactcggacgttgaaactgtggctgtgtccacctctgaccatgagaccggtgggctt
gtcacctccagacaagtatctccttcgtatccagattacatttggtatcccgaagtgctc
ttgaattgttcacattcgggtgagtttttgacatccaagattgttagtttcacccggtca
aacagcgatgctaaagttgttgaagacttcatcaccaaagagattttccagaatgatatg
ggaattcaagacgctactgcccaagaggtaaaggatgttaaggagaatctcagtactccg
ggtcagttactctacgttttgaacaacatgatctcattacggtctcaaactggatggact
acccacggccattcagccgttgatgtcaacatctatggggcagtttccaactttggatct
atcaagactcaattgtatcaatcggcagaaaatgtcggtcttttgggtaatcacgagaac
atcgagattggtaagtttatggaatcggttgccggagttgatttgagtaaaatcaccgaa
ttgctcaaggatactaaacaccatccttcttcagttgatgaaatcaacgccaattcattt
gaccaatatcatcaaacccaataa

DBGET integrated database retrieval system