KEGG   Candida tenuis: CANTEDRAFT_115976Help
Entry
CANTEDRAFT_115976 CDS       T03099                                 

Definition
hypothetical protein
Orthology
K12345  
3-oxo-5-alpha-steroid 4-dehydrogenase 3 [EC:1.3.1.22 1.3.1.94]
Organism
cten  Candida tenuis
Brite
Enzymes [BR:cten01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.22  3-oxo-5alpha-steroid 4-dehydrogenase (NADP+)
     CANTEDRAFT_115976
    1.3.1.94  polyprenol reductase
     CANTEDRAFT_115976
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 334 aa AA seqDB search
MDSIKHILVEQVNSNIMFFKLMYELLSDFTIDHWVALLASSLLMGLIIASSENVSSRIVL
YGKNYANQPNNPSYIPQNIWERVFVRVHKITVPKKYFLHFYVFFALLMVINAFVEWNFNT
NAFPQVNDFFASFYERFYTNYLTSEQNYKNLYVISNLLMIQSFRRLYECLFVSQFSDVSM
NILHYVFGLSYYWMVASVNFGGILPYYIYGQSNNYKVELDMSDWLFIGVFLTYSMDQFQN
HQHLAKLVKYTIPSFRLFEYCASPHYLDEIILYSCIMRFYLCCKDIRWIQVDFVLIWCLV
VLNLSNSSSQTYKYYQDKFKEKFKIPYKLVPFVW
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atggactcaattaaacacatcttggtggagcaggtcaacctgaacatcatgttcttcaag
ctcatgtacgagctcttatctgacttcaccatcgaccattgggtggctcttttggccagt
agtcttttgatgggcctaatcattgccagctccgaaaatgtttcttccagaatagttcta
tatggtaaaaactatgccaaccagccaaataatcccctgtacattccccaaaatatctgg
gagagagtgtttgtcagagtgcacaaaatcaccgttccaaagaagtatttcctccatttc
tatgtcttctttgctttgcttatggtaattaacgcctttgtggaatggaatttcaacact
aacgcttttcctcaagtcaatgacttctttgccagcttctacgaacgattctacaccaac
tatcttacctcggaacaaaactataaaaatttgtatgtgatctccaacttgctcatgatc
cagtctttcagacggttatacgaatgcttatttgtgtctcagttttccgacgtttccatg
aacattctccactacgtgtttgggttgctgtactactggatggttgcctccgttaacttt
gggggcattttaccctactacatctatggtcaatccaacaactacaaagtcgagttggac
atgtctgactggctttttatcggagtgtttttgacttatctgatggaccaattccaaaac
caccaacacttggccaagcttgtcaagtacacaattccgtcgttccgtctctttgaatac
tgtgcatctccacactatcttgatgaaatcattttgtattcatgtataatgaggttttat
ttgtgctgtaaagacatcaggtggatacaagtggactttgtgttgatttggtgcttagtg
gtattaaacctttctaatagttccagtcagacgtacaagtactaccaggacaagttcaag
gagaagttcaaaattccctataaattagttccatttgtgtggtga

DBGET integrated database retrieval system