KEGG   Corynebacterium terpenotabidum: A606_04015Help
Entry
A606_04015        CDS       T02714                                 

Definition
hypothetical protein
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
cter  Corynebacterium terpenotabidum
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:cter00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    A606_04015
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    A606_04015
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    A606_04015
Enzymes [BR:cter01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     A606_04015
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
947969..949675
Genome map
AA seq 568 aa AA seqDB search
MTTFSSGLTRRHFLVGTAGAASTAGLAALGAAVSFAGTADADAGDDTGAFLHSVASGDPL
PEAVVLWTRVTPAPDATPGSGRGAATTVRWEISTGPEFSFLTASGEVTTDASLDHTVKVD
VGGLSPATDYHYRFTVLDGPAAGSVSRTGRTHTAPAPGADPGQLRFAVCSCSNYEAGYFR
AYRDLADRDDLEFTLHLGDFTYEYATGEYTAAHGTVVRRVEPAQRTLTLDDFRIRQGHYH
RDADLADLLAARPLIATWDDHEFADNSWREGATGDHEHSGAEFQALKESASQAYREWMPV
RDGVLQRHLRFGTLAEFIIPDLRSYRDEQAAVTATWTGTDNRTLMGSDQFDWFSDVLTTS
DTRWQLIGNQVMFAPMTLPDTLDPRIHDWLVGQIGLPADGLALNADQWDGYMAERRRVID
LIVDTKPDGVVFLTGDIHTSWAADIPVNPGDYRLGRDMRVAATEFIGPSVTAASAFDSIA
VSPELDAPVLEALQLGEQIITEVDSWFHYVDLTQHGYLTVDVDADRVRADWYHGSVLTPD
APVTRTTSYQAVYGAPGVRPVDDGADGA
NT seq 1707 nt NT seq  +upstreamnt  +downstreamnt
gtgacgactttttcctccggcctgacccgccgccacttcctcgtcggtactgccggcgct
gccagcactgctggactcgccgctctcggcgccgcagtgtcgttcgccggcaccgccgac
gctgacgccggggacgacaccggtgccttcctccactccgtcgcctccggtgacccgtta
ccggaggcggtggtgctgtggacacgggtgacccccgcaccggacgccactccgggatcg
ggacgcggtgcggcgaccacggtgcgctgggagatctcgaccggtccggagttcagcttc
ctcaccgcgtccggggaagtcaccaccgacgcctccctggaccacacggtgaaggtcgat
gtcggtggtctttcgccggcgaccgactaccactaccgtttcaccgtgctcgacgggccg
gcggcagggtcggtctcccggaccggtcggacccacaccgcaccggctcccggggcggat
ccggggcagctgcggttcgccgtatgctcctgctcgaactacgaggccgggtacttccgc
gcctaccgggacctcgcggaccgggatgacctggagttcaccctccacctcggcgacttc
acctacgagtatgcgacgggggagtacaccgctgcccacggtaccgtcgtgcgtcgcgtc
gagcccgcacaacgcaccctcaccctcgacgacttccgtatccgccaggggcactaccac
cgggacgcggacctcgctgatctgctcgccgcgcgtcccctcatcgcgacctgggacgac
cacgagttcgccgacaacagctggcgtgagggggccaccggtgaccacgagcacagcggg
gcggagttccaggcattgaaggagagcgcctcccaggcgtaccgggagtggatgccggtg
cgcgacggagtgctgcaacgccacctgcggttcggcaccctcgccgagttcatcatcccc
gacctgcgcagctaccgggatgagcaggcggcagtcaccgcgacctggaccggcaccgat
aaccggaccctgatgggcagcgaccagttcgactggttctccgatgtcctgaccacctcc
gacacccgctggcagctcatcggcaaccaggtgatgttcgccccgatgaccctgccggac
accctcgatccgcgcatccacgactggctcgtggggcagatcggactaccggccgacggc
ctggcgctcaacgccgaccaatgggacgggtacatggcggaacgacgccgcgtcatcgac
ctcatcgtcgacacgaaacctgacggggtggtgttcctcaccggtgacatccacacctcc
tgggccgcagacatccccgtcaaccccggcgactaccgcctgggccgggacatgcgcgtc
gccgccaccgagttcatcggcccttcggtcaccgccgccagcgccttcgacagcatagcg
gtgagcccggaactcgatgccccggtgcttgaggccctgcagctgggtgagcagatcatc
accgaggtcgattcctggttccattacgtcgatctcacacagcacggctatctcaccgtc
gacgtggacgctgaccgcgtccgcgccgactggtaccacggcagcgtcctcacccccgac
gccccggtcacccgcaccacctcctatcaggcggtgtatggcgctccgggggtccgtccc
gttgacgacggagccgacggagcgtga

DBGET integrated database retrieval system