KEGG   Corynebacterium terpenotabidum: A606_04960Help
Entry
A606_04960        CDS       T02714                                 

Definition
glutaminase (EC:3.5.1.2)
Orthology
K01425  
glutaminase [EC:3.5.1.2]
Organism
cter  Corynebacterium terpenotabidum
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
D-Glutamine and D-glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cter00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    A606_04960
   00330 Arginine and proline metabolism
    A606_04960
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    A606_04960
Enzymes [BR:cter01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     A606_04960
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1153452..1154726
Genome map
AA seq 424 aa AA seqDB search
MEIPLKSYLTEILDRVRDRDSGAVADYIPELAAADPTPLAVALCTSAGRVYSAGDDEREF
SIQSISKSFTYAIALQEVGVEKVLGTVGMEPSGEAFNELSLEGGTHRPVNPMINAGAIAV
NQLINGEDSSVDARVTVLLDYFSRLAGRELHIDERITGSELATADRNLSLAHMLRSYGVI
AGSAADAVTGYVRQCSVLVTVRDLAVMGATLALGGRQPVTGEQVLDPRVCRQVQAVMASA
GMYDGAGRWMASVGIPAKSGVAGGLMGTLPGQLGLATFSPRLDSSGNSVRGAEIFRILSE
DMGLHLMSALPSTGSAVRSIRTRGPVTVIRLQGGLGFTGAEDFLAAAAAHELTTVRVVVD
MRRVSDIDAFGREMVLEGLRRIRTDGHRIAVIDPDHLLGDRRLGDGTTVEETDEVAVEVA
DEVK
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atggagatcccgctgaaaagttacttgactgaaatcctggaccgggtccgtgacagagat
tccggtgccgtcgccgactacatcccggagctcgcggccgcggacccgacaccgttggct
gtcgcactgtgcacctccgccggccgggtctacagcgccggcgacgatgagcgggagttc
agcatccagtccatctccaagtccttcacctatgccatcgccctgcaggaggtcggggtg
gagaaggtcctgggaacggtggggatggaaccgtccggcgaagccttcaacgagctctcc
ctcgagggagggacgcaccggccggtcaacccgatgatcaacgccggagccatcgcagtg
aaccagctgatcaacggggaggattcgtccgtggacgcccgggtgactgtcctgctggac
tatttctcccgactggcgggacgcgagctgcacatcgacgagcgcatcaccgggtccgaa
ctggccaccgcggaccgcaatctgtcgctggcacacatgctgcgcagctacggcgtgatc
gccggatccgccgccgacgcggtcaccgggtacgtccgtcagtgttccgtcctggtcacc
gtccgggatctcgcggtgatgggtgcgacccttgccctgggaggacgccaaccggtcacc
ggtgagcaggtcctcgatccgcgggtgtgccgtcaggtgcaggcggtgatggcctcggcg
ggaatgtacgacggggcgggcaggtggatggcgtccgtcgggatcccggcgaagtcggga
gtggccggcggtctgatggggacgctgcctggacaactgggcctggcgacgttctcgccg
cgactggattcctccggaaacagtgtgcggggtgcggagatcttccggatactgtccgag
gacatgggactgcacctcatgtccgccctgccgtcgacgggatcggcggtgcgcagtatc
cgcacccgtggtccggtgacggtgatcaggttgcagggcgggctcggtttcaccggggca
gaggacttcctcgccgcagcggcggctcatgagctgacgaccgtccgtgtggtggtggac
atgcggcgggtcagtgacattgacgccttcggccgagagatggtgctggagggattgcgg
cggatccggaccgacgggcaccgtatcgccgtgatcgacccggaccatctgctcggtgac
cggaggttgggcgacgggacgaccgtcgaggaaactgatgaggtggccgtcgaggtggcc
gatgaggtgaagtga

DBGET integrated database retrieval system