KEGG   Corynebacterium terpenotabidum: A606_05800Help
Entry
A606_05800        CDS       T02714                                 

Definition
phosphoenolpyruvate carboxylase (EC:4.1.1.31)
Orthology
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
cter  Corynebacterium terpenotabidum
Pathway
Pyruvate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:cter00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    A606_05800
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    A606_05800
  Energy metabolism
   00680 Methane metabolism
    A606_05800
Enzymes [BR:cter01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     A606_05800
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1347863..1350727)
Genome map
AA seq 954 aa AA seqDB search
MTGMPHTPAENGQQSSSTRHTVPGTAVPVAPPDVDIPDIVPGVRQDIRYLGAVLGDVVRE
QEGEEIFALVESARRASFDIRQGDGTVDDLAARLGDLPADRALPVIRAFSHFGLLANLAE
DLHEERVRDHLADAGNPPPASTLAATWPTLTDAGVTAGQVAEVMERAYVAPVLTAHPTET
RRRTVFDVQSDITRLMRNRGQIIAAGLTARSDERLAQIDRDIRRHVTVLWQTALIRSVRP
RIEDEINVGLRYYTISLLHEIPLLNLRVSTALREQFGDTVPDTPVLRPGSWIGGDHDGNP
FVTGETVSYATDRAAQTVFAWYLDELRDLEHELSLSTRLTDVLPELLDLAARGNNDVPSR
ADEPYRQAVHGIRGRLAATAVATLGASSVVPGIADGHTPYPDAASALADLAVIDTSLRAS
SDGLIADHRLATVITGLRTFGFHLSALDLRQNSESFENVLTEMLSRAGVTDHYADLGEEE
KVALLTAELHSPRPLIDPLAQWTEPTERELGIFRSAAAAARKFGPEVVPHCIISMASSVS
DILEPMLLLKEVGLIRVDGGVLQGSVDVIPLFETIDDLQAGAAVMTELWGFDFYRSYVTD
HRDGVQEIMLGYSDSNKDGGYFAANWALYDAELALVEASRAAGLGLRLFHGRGGTVGRGG
GPSHEAILAQPEGAVQGSVRITEQGEIISAKYGVRSVARRNLEALVSATLEASLLPVDRV
DGPDKAYATMRELAESSRLTYAALMHEDPGFIGYFTASTPLAEIGNLNIGSRPSSRKQTN
SIADLRAIPWVLSWSQSRIMLPGWYGVGSALSTWIDGDPARLAYLQSLHREWPFFRSVMS
NMAQVMAKADLAVARLYSGLVPDQTDASRIFDAIVKEFRLTLDMYVQVTGTESLLDDNPE
LAVSMRNRFPYLIPLNLLQLELLRRYRAGDESEDVLDGIRLTMNGLATGLRNSG
NT seq 2865 nt NT seq  +upstreamnt  +downstreamnt
atgacgggcatgccacacacacccgctgagaacggccagcagtccagctccacccggcac
accgtccccgggaccgcggtcccagtggcaccgcccgacgtggacatccccgatatcgtc
cccggcgtccgacaggacatccgctacctcggcgccgttctcggcgacgtggtgagggaa
caggagggggaggagatcttcgccctcgtcgaatccgcccggcgggcgtccttcgatatc
cggcagggcgacggcaccgtcgacgacctcgccgcccggctgggcgacctgcccgcggac
cgggcgctgcccgtcatccgggcgttcagtcacttcggcctgctggccaacctcgccgag
gatctgcatgaggaacgcgtccgagaccatctcgccgacgccgggaacccaccgccagcg
tccaccctcgccgccacctggcccaccctcaccgacgccggcgtcaccgccggacaggtc
gccgaggtcatggaacgggcctacgtcgcccccgtgctcaccgcacatcccaccgaaacc
cgccgccgcaccgtcttcgacgtgcagtccgacatcactcgactgatgcgcaaccgcggc
cagatcatcgccgccggactgactgcccgtagtgacgaacgcctcgcccagatcgaccgc
gacatccgacggcacgtcactgtcctgtggcagaccgccctgatccgctcggtgcgtccc
cgcatcgaagacgagatcaacgtgggtctgcgctactacacgatcagcctgctccacgag
attccgctgctgaacctgcgggtcagcaccgccctgcgggaacagttcggggacaccgtt
ccggacacccccgtgctgcggccgggctcgtggatcgggggtgaccatgacggcaacccc
ttcgtcaccggagagaccgtcagctacgcgaccgaccgcgccgcccagaccgtcttcgcc
tggtacctcgacgaactccgtgatctggagcacgaactcagcctctcgacccggctcacc
gatgttctccccgagctgctggacctcgccgcccgcgggaacaatgacgttccctcccgg
gccgatgaaccctaccgccaggccgtccacggcatccgcggtcggttggcggccacggcc
gtggcgacgctcggggcgtcctccgtcgtccccggtatcgccgacggtcacaccccgtac
ccggacgccgcgtcggcattggccgacctggccgtcatcgatacctccctgcgagcctcc
agcgacggactcatcgccgaccaccggctcgccaccgtcatcaccgggctgcgtaccttc
ggcttccacctcagcgccctggacctgaggcagaactcggagagcttcgagaacgtgctc
accgagatgctctcccgcgccggcgtcaccgatcactacgcggacctgggggaggaggag
aaggtcgcactgctcaccgccgagctgcactcgccgaggccgctgatcgacccgctggcg
cagtggactgaaccgaccgagcgggaactcggaatcttccgctccgcggcggccgcagcc
cgcaagttcggacccgaggtggtgccgcactgcatcatctccatggcgtcctcggtgtcc
gacattctcgagccaatgctgctgctcaaggaggtcggcctgatccgggtcgacggagga
gttctccagggttccgtcgacgtcatccccctgttcgagaccatcgacgacctgcaggcc
ggcgcggcggtgatgacggaactgtggggattcgacttctaccgcagctacgtgaccgac
caccgcgacggtgtgcaggagatcatgctcggttactccgactcgaacaaggacggcggc
tacttcgcggcgaactgggcgttgtacgacgccgaactcgccctcgtcgaggcgtcccgt
gccgccggactcggactgcggctcttccacggtcggggcggtaccgtcgggcgcggcggc
ggccccagccatgaggccatcctcgcccagccggaaggcgcggtgcagggcagcgtccgg
atcaccgagcagggcgagatcatctccgcgaaatacggggtgcgctccgtggcccgacgc
aacctcgaggccctggtctcggcgacgctggaggccagtctgctgccggtggaccgggtc
gacggaccggacaaggcctacgccacgatgcgggagctggctgagagctcccggctgacc
tatgcggcgctgatgcacgaggacccggggttcatcggctacttcactgcgtcaacaccg
ctggcggagatcggcaacctcaatatcggatcccgtccgagttcccggaagcagacgaac
agtatcgcggacctgcgggcgatcccgtgggtgctgtcctggtcgcagtcgcggatcatg
ctgcccggctggtacggggtagggtccgcgctgagtacgtggatcgacggagatcccgcg
cggctggcatacctgcagtccctgcaccgggagtggccgttcttccggtcggtgatgtcc
aatatggcgcaggtgatggccaaagctgatctcgcggtcgcccgcctgtactccgggctg
gttccggaccagaccgacgcgtcacggatcttcgatgcgatcgtcaaggagttccgcctg
accctcgacatgtatgtccaggtcaccgggacggagagtctgctcgacgataacccggag
ctcgcggtctcgatgcgtaaccgcttcccgtacctcatcccgctgaacctcctgcagttg
gagctgctgcgccggtaccgtgccggtgatgaatcggaggatgtcctcgacgggatccgg
ttgacgatgaacggcctcgccacgggcctccgcaactccgggtag

DBGET integrated database retrieval system