KEGG   Corynebacterium terpenotabidum: A606_11825Help
Entry
A606_11825        CDS       T02714                                 

Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
cter  Corynebacterium terpenotabidum
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:cter00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    A606_11825
Enzymes [BR:cter01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     A606_11825
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2726085..2727056
Genome map
AA seq 323 aa AA seqDB search
MNDSPTVLVCGSVNVDSFVQVSDFPTAGETVIASPAGEPALGGKGANQAVAASRFGDCRV
ALSATVGTDAAGDLALGDLVDAGVDVSGVTVDADTSTGSAFIINDARGENIIIVTSGANI
LTDPSRVTTPDSAEILLAQGELTPAHSSSLPDLAERLGARLVLNLAPVTTRDRRLLATAD
PLILNETEAADVLGVLREIGLDEVLDGLVAAVGRGLARSAVVTLGAQGALVIDPGAGDSD
TVGPTMVPSPPAPQVVDTTGAGDAFCGTLAAALARGETLYDAARYAVAAGSLAVRAAGAA
PSYAKGDAVRALAAGVRPVDAGR
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgaatgactccccgaccgtcctcgtctgcggctccgttaatgtggacagcttcgtgcag
gtcagcgacttcccgacggcgggggagaccgtcatcgcatccccggccggggagcccgct
ctcggcgggaagggcgcgaaccaggccgtggccgcgtcccggttcggcgactgcagagtc
gccctgtccgccaccgtcgggacggatgccgccggcgacctcgccctcggggacctcgtg
gatgccggggtcgatgtctcgggcgtgacggtggacgccgacacctccaccggttcggcg
ttcatcatcaacgacgcgcgcggcgagaacatcatcatcgtcacctccggtgccaacatt
ctcaccgatccgtcgcgggtcaccacgccggactctgcggagatcctgctggcccaggga
gagctgacccccgcgcactcgtcatccctgcccgacctcgccgagcgtctcggcgcccgg
ctggtgctgaacctcgcccccgtcaccacccgggaccggcgtctcctcgccaccgctgat
ccgctgatcctcaatgagacggaagcagcggacgtgctcggcgtcctccgggagatcggc
ctggacgaagttctcgacggcctggtcgccgcggtgggcagaggcctggcccggtccgcg
gtggtgaccctcggggcacagggtgcactggtcatcgaccctggcgccggagacagtgac
acggtcggcccgaccatggttccctcgccgccggcgccccaggtggtggacaccaccggc
gcgggcgacgccttctgcggcaccctggccgccgcgttggcccggggggagacgctctac
gatgccgcacggtacgccgtcgccgccgggtcgctggccgtcagagcagccggtgcggca
ccctcctacgcgaagggggacgccgtgcgcgccctggccgccggggttcgaccggtggac
gccggacggtag

DBGET integrated database retrieval system