KEGG   Clostridium tetani 12124569: BN906_00689Help
Entry
BN906_00689       CDS       T02905                                 

Definition
alkaline phosphatase
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
ctet  Clostridium tetani 12124569
Pathway
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:ctet00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    BN906_00689
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    BN906_00689
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    BN906_00689
Enzymes [BR:ctet01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     BN906_00689
Exosome [BR:ctet04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BN906_00689
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(666914..668569)
Genome map
AA seq 551 aa AA seqDB search
MFKFKRKKCITFFLSLAMTLNFLMVPNFNKVSASPSKVKNVILLVPDGTGITHTTLARWY
KGGEPLAMDEIACGLIRTYSSDAIIADSAPAATAMATGYKSHTGFISVLPDVANMPLLNP
IKKGEERRPVASILEGAKLNGMATGIVATCELPHATPASFTSHYPNRKAYDTLSEQMVYN
DLDILFAGGHDVLIPEKRADKEDMLKILQSKGYDIVKDAEELKNTQAKKVWGLFAPMALD
YEFDRSYEQPSLSDMTQKAIDILSNSKKDGFFLMVEGSKIDWASHANDPIGVISDTLAFD
NAVSVALNFAKKDKDTVVIVAPDHSNGGMTIGDSTLDKTYDNQPLSTIVAPLKRAKLTGE
GLGKKLNVDRSNIKEIMSAYYGIDDLTAKEEQAIKTCDINKVIDIVGPMISKRAHIGWTT
KGHSGEEVGLYVYHPKGIRPTGVIQNTDVNKYMCEVLGINLQHVTDTLFLQAEKTFKENE
ATLSVDSSDKENLVLIVTKDDKTVKFPQNKNIAIVGDETIELPGVTVYTGTKENIEIAKW
YLSDKAVNLIK
NT seq 1656 nt NT seq  +upstreamnt  +downstreamnt
atgtttaaatttaagagaaaaaaatgtattacctttttcttatcattagctatgacatta
aactttttaatggtacctaactttaataaggtatcggcaagccctagtaaagttaaaaat
gttatcttattagttcctgatggcactggaataactcataccactctagcaagatggtat
aaaggtggagaacctcttgctatggatgaaattgcctgtggtcttattagaacctattct
tccgatgcaatcattgcagactcagctccagcagctactgccatggcaacaggttataaa
tcacacactggatttatttctgttctcccagatgtggcaaacatgcctctactaaatccc
ataaaaaagggagaagaaagacgtcctgtggcttctatattagaaggtgctaaattaaat
ggaatggcaacaggtattgtagcaacttgtgaactacctcacgcaacccctgcaagtttt
acttcccactatccaaatagaaaagcatatgatactttaagtgagcaaatggtatataat
gatttggatattttatttgcaggaggtcatgatgttttaattcctgaaaaaagagctgat
aaagaagatatgctcaagattttacaaagtaaaggatatgatattgttaaagatgcagaa
gaattaaaaaatactcaagctaaaaaggtttggggactttttgcacctatggctttagat
tatgagtttgatagatcttatgaacagccaagtctttctgatatgacccaaaaagctatt
gatattttatccaacagtaaaaaagatggttttttcttaatggtagaaggtagtaaaata
gactgggcttctcatgctaatgatccaataggagttattagtgatactttagcctttgat
aatgcagtttcagtagcattaaattttgcaaagaaagataaagatactgtagtaatagtt
gctcctgaccacagtaatggtggcatgaccattggtgattcaactttagataaaacctat
gataatcaacctctttcaactatagtagcacctcttaaaagagcaaaacttacaggagaa
ggcctaggtaaaaagctaaatgtagacagaagtaatataaaagaaattatgtcagcatat
tacggtatagatgatttaacagctaaagaagaacaagctataaaaacttgtgatattaat
aaagttattgatattgtaggtcctatgataagcaaaagagcccatataggttggactaca
aagggccattctggtgaagaagttggactatatgtttatcatccaaagggcataagacct
acaggagttattcaaaacactgatgttaacaaatatatgtgtgaagttttaggtataaat
cttcaacatgttacagatacactgttccttcaagctgaaaaaacctttaaagaaaacgag
gctaccctttctgtagattctagtgataaagaaaacttagttcttatagtaactaaagat
gataaaacagtaaagtttccacaaaataaaaatatagctattgttggagatgaaactata
gaattgcctggagttactgtttataccggcacaaaagagaatatagaaatagctaaatgg
tatttatctgataaagctgtaaatttaattaaataa

DBGET integrated database retrieval system