KEGG   Clostridium tetani 12124569: BN906_00958Help
Entry
BN906_00958       CDS       T02905                                 

Definition
ribokinase (EC:2.7.1.15)
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
ctet  Clostridium tetani 12124569
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:ctet00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    BN906_00958
Enzymes [BR:ctet01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     BN906_00958
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
946236..947156
Genome map
AA seq 306 aa AA seqDB search
MKKILVIGSFMMDLVAQTPRAPIEGETIIGKSFSQFTGGKGANQAVAAARLGAYVTMIGK
LGKDSFGEAHIESLRREGINHDYVLFDDVESSGVGHITLEENGNNRIIVIPGANLKLTPK
EVEDLEDNIKSSDIVILQLEIPFETVYKTIELAHKHGKTIILNPAPAAKLKEHFVELVDY
IVPNESEASLLTGIKVNSIESARKAAKSLLNLGCKNVIITLGEKGVLLVNNNEEIFQESF
KVKPVDTTAAGDSFIGAFAYSLANGLGNVKSLEFACAVGALTVTKIGAQPSLPKLTEVEM
FMKENR
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
gtgaagaagatactagtaataggtagttttatgatggatctagtggcacaaactccaaga
gcaccaatagagggtgaaacaattataggaaagtcatttagtcagtttacaggaggaaaa
ggtgcaaatcaagcagtagcggctgctagattaggtgcatatgtcactatgattggaaaa
cttggaaaggatagctttggagaagctcatatagaatccttaagaagagaaggtataaat
catgactatgtactatttgatgatgtagaaagttctggagtaggtcacataacattagaa
gaaaacggaaacaatagaataattgttattcctggagcaaacttaaagttaactcctaaa
gaagttgaggatcttgaagacaatattaaaagctcagatatagtaatacttcaacttgaa
atcccatttgaaactgtatataagactattgaattagcacataaacatggaaagacaata
attttaaatccggcaccggcagccaaattaaaggaacattttgtagaactagttgattat
atagttcctaatgaatcagaggcttcactattaactggcattaaagtaaatagtattgaa
agtgctagaaaagcagctaaaagtctccttaatttaggatgtaaaaatgttataattaca
ctaggagaaaaaggggtattacttgtaaataataatgaggaaatatttcaagaatcattt
aaagttaaaccagttgatacaactgcagctggagattcatttataggtgcatttgcttat
tcattagctaatggattaggaaatgtaaagtctttagaatttgcatgtgcagttggagca
ttgacagttacgaaaataggtgctcaaccatcacttccaaagcttacagaagttgaaatg
tttatgaaagaaaatagatag

DBGET integrated database retrieval system