KEGG   Chlamydia trachomatis D-LC: CTDLC_0205Help
Entry
CTDLC_0205        CDS       T01901                                 

Gene name
pfkA_1
Definition
Pyrophosphate--fructose 6-phosphate 1-phosphotransferase (EC:2.7.1.90)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
ctf  Chlamydia trachomatis D-LC
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ctf00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CTDLC_0205 (pfkA_1)
   01230 Biosynthesis of amino acids
    CTDLC_0205 (pfkA_1)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CTDLC_0205 (pfkA_1)
   00030 Pentose phosphate pathway
    CTDLC_0205 (pfkA_1)
   00051 Fructose and mannose metabolism
    CTDLC_0205 (pfkA_1)
   00052 Galactose metabolism
    CTDLC_0205 (pfkA_1)
  Energy metabolism
   00680 Methane metabolism
    CTDLC_0205 (pfkA_1)
Enzymes [BR:ctf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     CTDLC_0205 (pfkA_1)
Protein phosphatases and associated proteins [BR:ctf01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     CTDLC_0205 (pfkA_1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
230063..231742
Genome map
AA seq 559 aa AA seqDB search
MFEQKLMSSNKHASLCQKTPSLCRELQKAPALLLTEDIRFKALLNERIDSVAELFPCTYN
SPYYKFISKSDLSAETSPLKVGVMLSGGPAPGGHNVILGLLHSIKKLHPNSQLLGFIRNG
EGLLNNNTVEITDEFIEEFRNSGGFNCIGTGRTNIITEENKARCLQTANELDLDGLVIIG
GDGSNTATAILAEYFAKHQAKTVLVGVPKTIDGDLQHLFLDLTFGFDTATKFYSSIISNI
SRDALSCKGHYHFIKLMGRSSSHITLECALQTHPNIALIGEEIAEKSISLETLIHDICET
IADRAAMGKYHGVILIPEGVIEFIPEIQSLVKEIESIPEQENLYQALSLSSQQLLCQFPE
DICHQLLYNRDAHGNVYVSKISVDKLLIHLVRQHLETHFRQVPFNAISHFLGYEGRSGTP
THFDNVYSYNLGYGAGVLVFNRCNGYLSTIEGLTSPIEKWRLRALPIVRMLTTKQGKDSK
HYPLIKKRLVDIASPVFNKFSLYRKIWALEDSYRFVGPLQIHSPEDAHSDDFPPLILFLN
HNEWQKRCSICLEIPDQDY
NT seq 1680 nt NT seq  +upstreamnt  +downstreamnt
gtgtttgagcaaaagcttatgtcgtcgaataaacatgcttctctttgtcaaaagacgcct
tctttgtgtcgggagcttcaaaaagctcctgctcttctattaacagaagacataaggttt
aaagctcttcttaatgaacgcattgactctgttgcagaactatttccatgcacttataac
tctccctactacaaatttatttcgaagtccgatctttccgctgagacctctccccttaaa
gtgggcgttatgctttctggaggcccagctcctggtgggcacaatgtcatcttaggattg
ctacacagtattaaaaagctccatccgaatagtcagcttttaggatttattcgcaatgga
gaaggacttctcaataataatactgtagaaatcacagatgaattcattgaagagtttcgt
aactctggaggctttaattgcataggaacaggtcgcactaatatcataaccgaagaaaat
aaagcgcgctgtttacaaacagcaaatgaactcgatttagatggattagtgattattgga
ggcgatggttcgaatacagccacggcgattcttgctgaatattttgctaagcatcaagca
aaaacggtattagttggtgttcccaaaactattgatggagatttgcagcacctattttta
gacctcacatttgggtttgatactgctactaaattttattcatccatcatcagcaacatt
tctagagacgcattatcgtgtaaaggccactatcattttattaaactaatgggccggtct
tcttctcatatcacgctagaatgcgcactacagactcacccaaatattgctcttataggc
gaagagattgcagaaaaaagcatctccttagaaacattaatccatgatatttgtgaaaca
atagcagatcgagctgctatggggaaataccatggcgttattctcatccctgaaggagtc
attgagtttattcctgaaatacagtctctggttaaagaaattgaatccattccagagcag
gagaatctttaccaagctttatccttatcttctcagcaacttttatgccaatttccggaa
gatatttgccatcagctcttgtataatagagatgctcatggcaacgtctatgtatcaaaa
attagtgttgataaacttctgattcatctagttcgtcaacatttagaaacacattttaga
caagttcccttcaatgcaatctcccattttttaggttatgaagggcgttcaggaactcct
acacattttgataatgtgtatagctataacttaggatatggtgctggggttctcgttttt
aaccgctgtaatgggtatttatccacgatcgaaggtctaactagccctattgaaaaatgg
cgattgcgcgctttacccattgttcgaatgttgacgaccaagcaggggaaagacagtaaa
cattatcctctgataaaaaaaagattggtagatattgctagtcctgtttttaataagttc
tcactgtatcggaaaatctgggctttagaagactcctatcgctttgtagggccattacaa
atacattctccggaggatgctcattctgatgattttcctcctttaattttgtttttgaat
cataatgaatggcaaaaacgctgttctatttgtttagaaatccccgatcaggattattaa

DBGET integrated database retrieval system