KEGG   Chlamydia trachomatis D-LC: CTDLC_0247Help
Entry
CTDLC_0247        CDS       T01901                                 

Gene name
pdhC
Definition
(GenBank) Dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase complex
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
ctf  Chlamydia trachomatis D-LC
Pathway
ctf00010  Glycolysis / Gluconeogenesis
ctf00020  Citrate cycle (TCA cycle)
ctf00620  Pyruvate metabolism
ctf01100  Metabolic pathways
ctf01110  Biosynthesis of secondary metabolites
ctf01120  Microbial metabolism in diverse environments
ctf01130  Biosynthesis of antibiotics
ctf01200  Carbon metabolism
Module
ctf_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:ctf00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CTDLC_0247 (pdhC)
   00020 Citrate cycle (TCA cycle)
    CTDLC_0247 (pdhC)
   00620 Pyruvate metabolism
    CTDLC_0247 (pdhC)
Enzymes [BR:ctf01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     CTDLC_0247 (pdhC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh E3_binding Biotin_lipoyl Biotin_lipoyl_2 Transferase
Motif
Other DBs
NCBI-ProteinID: ADI51935
Position
275568..276857
Genome map
AA seq 429 aa AA seqDB search
MVSLLKMPKLSPTMEIGILVKWHKKAGDEIHFGDVLLEISTDKAVLEHTASEDGWLLEIL
VEEGTKTPIGTPIAVFSTEQNAQYDLKQLLPLEGTVVTDAATEASPKNSAQTDSQYTSGP
SITMMGFRPEPPLAIPLTIKHSNDPVLASPLAKKLAKEQNLDLSGVTGSGPGGRIVKKDL
EKAPPLRIAGFGYPEAPNVNPGSYIEEPLSPVREVISKRLQAAKTFIPHFYVRQRIYASP
LLALLKELQEQNIKLSINDCIVRACALALKEFPEINSGFNSVDNKIIRFSTIDISIAVAI
PDGVIAPIVRCADRKNIGMISAEIKGLATKAKQQSLAEEEYKGGSFCVSNLGMTGISDFT
AILNPPQAAILAVGSVEEQPVVLNGELAVGLTCMLTLSVDHRVIDGYPAAMFMKRLQRLL
EAPSVLLLN
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
gtggtttctttgttaaaaatgcctaagctctcccctacaatggaaatagggattcttgtt
aaatggcacaaaaaagctggggatgaaattcatttcggggatgtattactagaaatctct
actgataaagctgttttagaacatacagcttctgaagatggttggttattagaaattctt
gttgaagaaggaaccaaaactcctattggcactcctatcgctgtattttcaacagaacaa
aatgctcaatatgatttaaaacagctcctacctttggaaggaactgttgttacagatgca
gctacagaagcatcgccaaaaaactctgctcaaacagattctcaatacacaagtggccct
tccataactatgatgggattccgtccggaaccacctttagctattcctctaactattaaa
cattccaacgatccagtattagcttctcctttagcaaaaaaattggccaaagagcaaaat
ctagacctctctggagtaactggtagtggacctggaggacggatcgtaaagaaagatttg
gaaaaagctcctcctttaagaattgctgggtttggttaccctgaagctccaaatgttaat
ccgggatcttatatagaagaacctctttcccctgttcgagaagtcatatctaaacgtctg
caagctgctaaaacctttattcctcacttttatgtaaggcagcgcatttacgcttccccc
cttcttgcattattaaaagaacttcaagaacaaaatattaagctctctatcaatgattgt
attgtacgagcctgtgctttagctctgaaagaattcccagaaattaattctggattcaat
agtgtcgacaataagattattcggttttctacgattgatatctctattgctgtagctatt
cctgatggagttatcgctcctattgtccgctgtgctgatagaaaaaatattggtatgatc
tctgcagaaatcaaaggacttgcaactaaagccaaacagcagtctcttgcagaagaagaa
tataaaggaggttctttctgtgtatctaatcttggtatgacagggatctctgatttcact
gctattttgaatcctccacaagctgctattctagctgtaggaagcgtagaggaacaacct
gtagtcttaaatggagagctagctgtaggcttgacctgtatgttgacattgtcggtagac
cacagagtgattgatggatatcctgcagccatgttcatgaaacgactgcagagactcctc
gaagctccttctgttttacttctcaattaa

DBGET integrated database retrieval system