KEGG   Chlamydia trachomatis D-LC: CTDLC_0400Help
Entry
CTDLC_0400        CDS       T01901                                 

Gene name
sucB_2
Definition
(GenBank) lipoamide acyltransferase component (E2) of branched-chain alpha-keto acid dehydrogenase complex
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
ctf  Chlamydia trachomatis D-LC
Pathway
ctf00020  Citrate cycle (TCA cycle)
ctf00310  Lysine degradation
ctf01100  Metabolic pathways
ctf01110  Biosynthesis of secondary metabolites
ctf01120  Microbial metabolism in diverse environments
ctf01130  Biosynthesis of antibiotics
ctf01200  Carbon metabolism
Module
ctf_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:ctf00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CTDLC_0400 (sucB_2)
  Amino acid metabolism
   00310 Lysine degradation
    CTDLC_0400 (sucB_2)
Enzymes [BR:ctf01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     CTDLC_0400 (sucB_2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2
Motif
Other DBs
NCBI-ProteinID: ADI52088
Position
complement(458433..459599)
Genome map
AA seq 388 aa AA seqDB search
MFEFRFPKIGETASGGIVVRWLKQVGDPVQKDEPLIEVSTDKIATELAPSQAGILEECLV
QEGEEVFPGDILARLLETAAANTPVKSPVENPVREENHSVDREQKWFSPAVLGFAQREGL
DLQELQKISGTGEGGRITRKDVEHYLSDKREPRDPICSKEENRIPLSPLRRAIASSLRQS
SEEVPHASLVVDVDVTDLMNLISAERERFTAAHGVKLTITSFIIQCLAKSLEQFPLLNGS
LDGDTIVLKKAINVGVAVNLNKEGVVVPVIHNCQDRGLVSIAKVLADLSSRARSNKLDSS
ETKGGSVTVTNFGMTGALIGMPIIRYPEVAILGIGTIQKRVVVRDDDSLAIRKMMCVTLT
FDHRILDGIYGGEFLTALKNRLESVTMS
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgttcgagtttcgatttccaaaaataggggagaccgcatctggaggtattgttgtccga
tggttgaaacaggtcggagatcctgttcaaaaagatgagccattgattgaggtctcaaca
gataagatagctacagagttagctccttctcaagctggcattttggaggagtgcctggtt
caggaaggggaagaggttttccctggagatattctagcgcgtttgctagaaactgctgca
gcgaatactcctgtaaaaagccctgtggagaatcctgttagagaagagaatcattctgta
gatagagagcagaaatggttctcgcccgcagtattaggatttgcccaaagagaagggtta
gatcttcaagaattacaaaagatctcggggacaggagaggggggacggattactcgtaag
gatgtagaacactatctttccgacaagagagaacctagggatccgatctgttctaaagag
gaaaatagaattcctttgtcacctttacgtcgggctatcgcttcttctttacgacagtct
tcagaagaggtgccgcatgcttctctggttgttgatgtagatgttacagatttaatgaat
ctcatctctgcggagcgagagagatttactgctgctcatggagtgaaactcacgatcacc
agcttcattatacagtgcttagctaagtctttagagcagttcccactgcttaatggttct
ttagacggggatacgattgtcctcaagaaggctataaatgtaggagttgctgtaaatttg
aataaagaaggagtagttgttcctgttattcataattgtcaggataggggtcttgtaagt
attgctaaggttcttgcggatctttcttcaagggcgcgatctaataaattagattcctca
gaaacgaaagggggaagcgtcactgtaaccaactttggtatgactggagctcttattggc
atgccgataattcgttatccggaagtagcgattttggggatcggaacaattcaaaaacga
gtggttgtacgtgatgatgactcgttagccattaggaaaatgatgtgtgtcactttaact
ttcgaccatcgaatattggatggaatttacggtggagagtttttaacagctttgaaaaat
cgcttagagtctgttacgatgagctaa

DBGET integrated database retrieval system