KEGG   Chlamydia trachomatis D-LC: CTDLC_0612Help
Entry
CTDLC_0612        CDS       T01901                                 

Gene name
folA
Definition
Dihydrofolate reductase (EC:1.5.1.3)
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
ctf  Chlamydia trachomatis D-LC
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:ctf00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:ctf00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(691821..692318)
Genome map
AA seq 165 aa AA seqDB search
MGWYVCMIQATGIVAIDPRGVMGALGKLPWSYPEDLRFFAETIRNHPIIMGRKTWESLPD
KYKHGRDIVVFSRRMHPPQCIGVSSFAEYGTLSLNHPFLIGGAELFESFFQQNLLKACFV
THIKKEYWGDTFFPITRLSGWKKECICNTEDFSIYYYENNSDQNT
NT seq 498 nt NT seq  +upstreamnt  +downstreamnt
ttgggctggtatgtttgtatgatccaagcaacaggtatcgttgctattgatcccagagga
gtgatgggagctttaggcaagctcccttggagttatcccgaagatctacgtttttttgca
gaaaccattcgaaatcatcccatcattatgggacgaaagacttgggagtctcttccagac
aagtataagcatgggcgggatatcgttgtcttttctcgcaggatgcatccaccacaatgc
ataggagtttcttcctttgcagagtatgggacactatctttgaatcatccgtttttaatt
gggggagcggagctctttgaaagttttttccaacaaaaccttctgaaagcttgttttgtc
acacatatcaaaaaggaatattggggcgatactttcttccctatcacgcgattatcagga
tggaagaaggaatgtatttgtaatacagaggatttcagtatttattattatgaaaataac
tccgatcaaaacacgtaa

DBGET integrated database retrieval system