KEGG   Chlamydia trachomatis D-LC: CTDLC_0613Help
Entry
CTDLC_0613        CDS       T01901                                 

Gene name
folP
Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (EC:2.7.6.3 2.5.1.15)
Orthology
K13941  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase / dihydropteroate synthase [EC:2.7.6.3 2.5.1.15]
Organism
ctf  Chlamydia trachomatis D-LC
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:ctf00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(692297..693649)
Genome map
AA seq 450 aa AA seqDB search
MTSWNFVCLSLGSNLGNRHEHIRRAYASLKKAGIRNLKSSVILETKALLLEGAPKEWDLP
YFNSVVIGETQLSPDELIEEIKMIESRFGQDASLKWGPRPIDIDVLFYGDEAFSYHSDKC
TIPHPKVLERPFLLSMIASLCPYRRFRLEGSSCNGKTFAELAAIYPLTEEDALGSFGSAT
QIMGIVNITDNSISDTGLFLEARRAAAHAERLFAEGASIIDLGAQATNPRVKDLGSVEQE
WERLEPVLRLLAERWGAAQQCPDVSIDTFRPEIIRRAVEVFPIRWINDVSGGSLEMAHLA
KEFGLRLLINHSCSLPPRPDCVLSYEESPIEQMLRWGESQLEQFAQVGLDTSWQVVFDPG
IGFGKTPVQSMLLMDGVKQFKRVLECPVLIGHSRKSCLSMLGRFNSNDRDWETIGCSVSL
HDRGVDYLRVHQVEGNRRALAAAAWAGMFV
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
atgactagttggaattttgtttgtttaagtttgggttccaatttaggtaaccggcatgag
catataagacgcgcttatgcaagtttaaagaaggctgggatccgaaatttaaaaagttct
gtgattttagagacgaaggctttgttgttagaaggggctccgaaagaatgggatcttcct
tattttaactctgtggttattggggaaacgcagctatctccagacgagttgattgaagaa
atcaagatgatagaaagtcgttttggacaagatgcttctttgaaatgggggcctcgaccg
attgatattgatgtgcttttctatggagacgaagctttttcttatcatagtgacaaatgt
acaatcccacatcctaaggtattagaaagaccttttcttctttctatgatagcttcttta
tgtccgtatcgtcgtttccgtttggaaggatcttcttgtaatgggaaaacgtttgcagag
cttgctgctatttatccattgacggaggaggatgcgttaggcagtttcggttctgctacc
caaattatgggtattgttaatattacggataactcgatctccgatacaggattgtttctg
gaggcgagaagagccgcagcccatgctgagagactctttgcagaaggagcttctattatt
gatttaggggcgcaagcaaccaatcctcgtgtaaaagatttaggaagcgtagaacaagag
tgggagcgtctagaacctgttttgcgtttattagcggagcggtggggggctgctcaacaa
tgccctgatgtatctatcgatacatttcgtccagagattattcgacgagctgttgaagta
tttccgattcgttggatcaatgatgtttctggaggctctttggaaatggctcatttggcg
aaggagtttgggctacggctattaataaatcattcgtgttcgctgcctccaagaccagat
tgtgtactttcttatgaagaatctcctattgagcaaatgttgcgttggggagagtctcag
ttagaacaatttgctcaagtaggtttagatacaagttggcaagttgttttcgatccagga
ataggatttgggaagactcccgttcagtcgatgttattgatggatggagtaaagcagttt
aaacgtgttttagagtgtcctgtattaataggccattctagaaaatcgtgtttgagtatg
ttgggccgatttaatagtaacgatcgtgattgggaaacgatcggctgttctgtatctctt
catgatcgaggagttgattatctacgcgtgcatcaggttgaaggtaacagacgtgcctta
gccgctgctgcttgggctggtatgtttgtatga

DBGET integrated database retrieval system