KEGG   Chlamydia trachomatis D-LC: CTDLC_0722Help
Entry
CTDLC_0722        CDS       T01901                                 

Gene name
pgm
Definition
(GenBank) Phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
ctf  Chlamydia trachomatis D-LC
Pathway
ctf00010  Glycolysis / Gluconeogenesis
ctf00260  Glycine, serine and threonine metabolism
ctf00680  Methane metabolism
ctf01100  Metabolic pathways
ctf01110  Biosynthesis of secondary metabolites
ctf01120  Microbial metabolism in diverse environments
ctf01130  Biosynthesis of antibiotics
ctf01200  Carbon metabolism
ctf01230  Biosynthesis of amino acids
Module
ctf_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:ctf00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CTDLC_0722 (pgm)
  Energy metabolism
   00680 Methane metabolism
    CTDLC_0722 (pgm)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CTDLC_0722 (pgm)
Enzymes [BR:ctf01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     CTDLC_0722 (pgm)
Membrane trafficking [BR:ctf04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    CTDLC_0722 (pgm)
Exosome [BR:ctf04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   CTDLC_0722 (pgm)
  Exosomal proteins of melanoma cells
   CTDLC_0722 (pgm)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: ADI52411
Position
complement(833861..834550)
Genome map
AA seq 229 aa AA seqDB search
MLSMTLLILLRHGQSVWNQKNLFTGWVDIPLSQQGIQEAIAAGESIKHLPIDCIFTSTLV
RSLITALLAMTNHSSQKVPYIVHEERPDMSRIHSQKEMEQMIPLFQSSALNERMYGELQG
KNKQEVAAQFGEEQVKLWRRSYRIAPPQGESLFDTGQRTLPYFQERIFPLLQQGKNIFIS
AHGNSLRSLIMDLEKLSEEQVLSLELPTGQPIVYEWTGQKFTKHAPSLG
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
ttgctctctatgacgcttcttatcttgctacgccatggccaatccgtatggaatcaaaaa
aatctgtttacaggctgggtagacatccctcttagccaacaaggaattcaagaggctatt
gccgctggagaatctattaaacatcttcctattgattgcatcttcacttccaccttggtt
agaagtttgataacagccctgttagcaatgactaaccacagctctcaaaaagttccttat
atcgttcatgaagagcgccccgacatgagccggattcatagtcaaaaagaaatggagcag
atgatccctctttttcaatctagcgctctcaatgaacgcatgtacggagaacttcaagga
aaaaataaacaagaagtcgctgctcaattcggagaagaacaggtaaaactgtggcgccga
agctaccgcattgcccctcctcagggcgaaagtcttttcgatacagggcaacgaaccctc
ccctattttcaagagagaattttccctctccttcagcaagggaaaaatatttttatctct
gctcacgggaattctttgcgctccttaattatggacctagaaaaattatctgaagaacaa
gtactctctttggagttgccaacaggacagcctattgtatacgaatggacgggacaaaaa
ttcacgaaacacgctccttctcttggttaa

DBGET integrated database retrieval system