KEGG   Chlamydia trachomatis D-LC: CTDLC_0774Help
Entry
CTDLC_0774        CDS       T01901                                 

Gene name
cysQ
Definition
(GenBank) 3'(2'),5'-bisphosphate nucleotidase
  KO
K01082  3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
ctf  Chlamydia trachomatis D-LC
Pathway
ctf00920  Sulfur metabolism
ctf01100  Metabolic pathways
ctf01120  Microbial metabolism in diverse environments
ctf01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:ctf00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    CTDLC_0774 (cysQ)
Enzymes [BR:ctf01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     CTDLC_0774 (cysQ)
Transfer RNA biogenesis [BR:ctf03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    CTDLC_0774 (cysQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Inositol_P zf-BED
Motif
Other DBs
NCBI-ProteinID: ADI52461
Position
complement(907624..908688)
Genome map
AA seq 354 aa AA seqDB search
MIVTSLQPAEKLMFSLLNDCQKAAETVVMQAMLSLMRYRKAHKFIPFWKKPDQTYVTPAD
YAIQYYFYQKLTSLFPHIPLVGEETLNPATDHPRIPQILQFAQQLDPKVSCQDLYQALSP
ESSHSSLFWLTDPIDGTSGFIKQRCFAIALSLFYEHTPVLSVIACPSSENNSFKIYSAAK
GEGLTICNPTHSFPFSLHEDFQPTCKFCEASLSARNHQHLTTHILSKHLPWNPQPIRADS
QCKYAWVADNTVDFFIRIPYSPPRAHYRDHAPGVFLIEEAGGLVTDISGNPLPFSNPNLY
LDRHPLILASANEQMHSTILETLYKLRHQATQNMLPLATHISATKHKQLSALQL
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
gtgattgttacctctttgcaaccagcggaaaagcttatgttctccctcctcaatgactgc
caaaaagctgcggaaacagttgtcatgcaggctatgctgtcactgatgcgctatcgaaaa
gctcataaatttattcccttttggaaaaagcctgaccagacatacgttactcccgctgat
tacgctatccaatattatttttaccaaaaactgacatctttatttccgcatatcccgctg
gtcggagaagaaactctcaatcctgccacggatcaccctaggatccctcaaatcctacaa
tttgcgcagcagctcgatcccaaagtctcctgtcaagatttgtatcaggccctctctccg
gaaagctcccactcttcactattttggttaacggaccctatcgacggtacttcgggattc
atcaaacaacgttgtttcgccatcgctctttctctattttacgaacatactcctgttctc
tccgttatcgcttgcccttcttctgaaaataactctttcaaaatctattcggcagccaaa
ggcgaaggacttacgatttgtaatcctacccattccttccccttctccctgcacgaagat
ttccaacctacctgtaaattctgtgaagcctccttatcagctagaaaccatcaacattta
actacacatattctcagtaaacatctcccttggaatcctcagcctatccgagcagatagt
caatgcaaatacgcttgggttgcagataatacggtagacttcttcattcgcatcccgtat
tcccctccacgagcccactacagagaccatgctcccggtgtgtttcttatagaagaagct
ggaggcctcgttacagatatatcggggaatcctctccctttttctaatccaaatttatat
ctagatagacatcctttgattcttgcttctgctaacgagcaaatgcatagcacgatttta
gagactctatacaaactacgtcaccaagctactcaaaacatgctcccccttgccactcat
atctctgctactaagcataaacagctaagcgctcttcaactatag

DBGET integrated database retrieval system