KEGG   Chlamydia trachomatis D-LC: CTDLC_0804Help
Entry
CTDLC_0804        CDS       T01901                                 

Gene name
ychB
Definition
(GenBank) 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
ctf  Chlamydia trachomatis D-LC
Pathway
ctf00900  Terpenoid backbone biosynthesis
ctf01100  Metabolic pathways
ctf01110  Biosynthesis of secondary metabolites
ctf01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:ctf00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    CTDLC_0804 (ychB)
Enzymes [BR:ctf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     CTDLC_0804 (ychB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_N
Motif
Other DBs
NCBI-ProteinID: ADI52490
Position
939787..940707
Genome map
AA seq 306 aa AA seqDB search
MLGEEILFFPTSFFYFLIMHFLSPAKLNLFLQILGRREDDFHEIVTRYQAIAFGDQLSLS
ISSRDSLQVINACHLETPSNSIWKSVALFRRYTGITTPVSWRVVKQIPVGAGLAGGSSNA
ATALFALNQIFKTGLSDEEMRSLAEQLGVDTPFFFSTGAALGVARGEKIIALEESVSDRY
VLYFSSEGVLTSRAFAAVQPSDCSSRKNLEYTQNDLEKPVFRLRLDLKEKKHWLENLWAE
LPVHIGLTGSGATLFVRYPEILEEDLSYAAQIQRAVTLSGGLLTSPIRRDPTAWYSIYSE
SALAAT
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
ttgttgggggaagagattcttttcttccccacctcttttttttattttttaattatgcac
tttctttctccagcaaagcttaatctctttttgcagatacttggcaggcgggaagatgat
tttcacgaaatagtcacacgctatcaagcgatagcctttggggatcaactctccttatca
ataagctctcgcgattctctccaagtaattaatgcttgtcatcttgaaacgcctagtaat
tctatatggaaaagtgtggcgcttttccgtcggtacacaggcattacaacgcctgttagt
tggcgtgtagtcaaacagatccctgttggagcaggtcttgcaggagggagtagtaatgca
gcaactgcattgtttgctttaaaccaaatcttcaaaacaggactatctgatgaggaaatg
cgttccttagccgaacagcttggcgtggatactccttttttcttttctacaggagcagcc
ttaggagtggcccgtggggagaaaataatagctctagaagagagtgtttcagatagatat
gttttgtatttttctagtgaaggagttctcactagtcgggcttttgccgccgtacaacct
tcggactgttcctccagaaaaaatttagagtatacgcaaaatgacttagaaaagcctgtt
tttcggttgcgcttagatttgaaagaaaagaaacattggctagaaaacctgtgggcggaa
cttcctgtgcatatagggctaacgggatcaggggcaaccttatttgtccgttacccagaa
atcttagaggaagacctttcttatgcagctcagatacaaagagcagtaacgttaagcgga
ggattattaacttctccgatacgaagagatcctacagcttggtatagcatctattctgaa
agtgcacttgcagctacataa

DBGET integrated database retrieval system