KEGG   Chlamydia trachomatis D-LC: CTDLC_0804Help
Entry
CTDLC_0804        CDS       T01901                                 

Gene name
ychB
Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (EC:2.7.1.148)
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
ctf  Chlamydia trachomatis D-LC
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:ctf00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
939787..940707
Genome map
AA seq 306 aa AA seqDB search
MLGEEILFFPTSFFYFLIMHFLSPAKLNLFLQILGRREDDFHEIVTRYQAIAFGDQLSLS
ISSRDSLQVINACHLETPSNSIWKSVALFRRYTGITTPVSWRVVKQIPVGAGLAGGSSNA
ATALFALNQIFKTGLSDEEMRSLAEQLGVDTPFFFSTGAALGVARGEKIIALEESVSDRY
VLYFSSEGVLTSRAFAAVQPSDCSSRKNLEYTQNDLEKPVFRLRLDLKEKKHWLENLWAE
LPVHIGLTGSGATLFVRYPEILEEDLSYAAQIQRAVTLSGGLLTSPIRRDPTAWYSIYSE
SALAAT
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
ttgttgggggaagagattcttttcttccccacctcttttttttattttttaattatgcac
tttctttctccagcaaagcttaatctctttttgcagatacttggcaggcgggaagatgat
tttcacgaaatagtcacacgctatcaagcgatagcctttggggatcaactctccttatca
ataagctctcgcgattctctccaagtaattaatgcttgtcatcttgaaacgcctagtaat
tctatatggaaaagtgtggcgcttttccgtcggtacacaggcattacaacgcctgttagt
tggcgtgtagtcaaacagatccctgttggagcaggtcttgcaggagggagtagtaatgca
gcaactgcattgtttgctttaaaccaaatcttcaaaacaggactatctgatgaggaaatg
cgttccttagccgaacagcttggcgtggatactccttttttcttttctacaggagcagcc
ttaggagtggcccgtggggagaaaataatagctctagaagagagtgtttcagatagatat
gttttgtatttttctagtgaaggagttctcactagtcgggcttttgccgccgtacaacct
tcggactgttcctccagaaaaaatttagagtatacgcaaaatgacttagaaaagcctgtt
tttcggttgcgcttagatttgaaagaaaagaaacattggctagaaaacctgtgggcggaa
cttcctgtgcatatagggctaacgggatcaggggcaaccttatttgtccgttacccagaa
atcttagaggaagacctttcttatgcagctcagatacaaagagcagtaacgttaagcgga
ggattattaacttctccgatacgaagagatcctacagcttggtatagcatctattctgaa
agtgcacttgcagctacataa

DBGET integrated database retrieval system