KEGG   Chlamydia trachomatis RC-F(s)/342: CTRC342_04170Help
Entry
CTRC342_04170     CDS       T02764                                 

Definition
protoporphyrinogen oxidase (EC:1.3.3.4)
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
ctfs  Chlamydia trachomatis RC-F(s)/342
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ctfs00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    CTRC342_04170
Enzymes [BR:ctfs01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     CTRC342_04170
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(907438..908712)
Genome map
AA seq 424 aa AA seqDB search
MKHALIVGSGIAGLSAAWWLHKRFPHIRLSILEKEARPGGLIITEKQKGFSFNMGPKGFA
LAHDGKHTLHLIQSLGLTGELVYNSPAAKHRFIHYNNKTRKLSPWTIFQQNLPLTLIKDL
FARPYKQDSSVEAFFKRHSSSKLRKNLLNPVSLAIRAGHSHILSAQMAYPELSLREAKTG
SLLRSYLKDFPRTNRKAPYLATLRTGMETLIQTLQEKLPATWHFSTPVTKIRQLANGKLS
LSCPSGEITGDLLVYAGSVQDLSSCLEEIPESKLLTQTTSSWDLSCTALGWHSSLLVPHG
YGMLFADTPPLLGIVFNTEIFPHSGQPNTVLSLLLEGRWHQEEAYAFSLAALAEHLQIYT
PPQAFSLFSPREGLPQHHVGFIRSRQIILSKLPKNIKIVGQNFAGPGLNRATASAYEAIA
SLRI
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atgaaacatgcattgattgttgggtctggtattgcaggtctttctgcagcatggtggcta
cacaaacgctttccacatatacgcctgtccattttagaaaaggaagctcgccctggtggg
cttattatcaccgaaaaacaaaaaggtttttctttcaatatggggccaaaaggctttgcc
ttggcccatgatggaaaacataccctccacctcatccagtctttaggtttaacaggagag
ctagtatataactctcctgcagctaaacatcgatttattcactataataacaaaacgcga
aaactttctccctggaccatttttcaacaaaatctccctctcaccctgattaaggattta
tttgctcgcccttataaacaagatagttctgtagaagctttttttaaaaggcatagctcc
tccaaattaagaaaaaacctcttaaatccggtaagtcttgctattcgagcaggccacagt
catattctttcggcacaaatggcttacccagaattaagtctgcgagaagcaaaaacagga
tctttattgcggagttatctcaaagactttcctagaacaaatcgaaaagccccttattta
gctaccttacgcacaggaatggaaaccctaatccaaaccctgcaagaaaagcttccggct
acatggcacttttctacgcctgttaccaaaattcgtcagttagctaatggaaaactttct
ctctcgtgcccatctggagaaatcacgggagatctcctcgtctatgccggatccgttcaa
gatctctcttcttgtttagaagaaatcccagaatctaagctcctaacgcaaacaacttcc
tcttgggacctatcctgcacagcattagggtggcattcttcgcttctcgtcccccatggg
tatggtatgctttttgcagatacccctcccttattaggtattgtttttaacacagaaatc
tttcctcattctgggcaaccgaataccgtactctccctccttttagaggggaggtggcac
caagaagaagcttacgccttctctctagcggctcttgctgaacatttgcaaatttatacc
cctcctcaggctttctctctgttctctcctcgagaaggccttcctcaacatcatgtggga
tttattcgatcacgacaaattattttgtctaaacttcccaaaaacataaaaattgtgggg
caaaactttgcggggcctggtctaaaccgagcaacagcatctgcttacgaagcgattgct
tctttacgaatatga

DBGET integrated database retrieval system