KEGG   Chlamydia trachomatis E/11023: E11023_00290Help
Entry
E11023_00290      CDS       T01902                                 

Definition
dihydrolipoamide succinyltransferase (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
ctg  Chlamydia trachomatis E/11023
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ctg00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    E11023_00290
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    E11023_00290
  Amino acid metabolism
   00310 Lysine degradation
    E11023_00290
Enzymes [BR:ctg01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     E11023_00290
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
63774..64871
Genome map
AA seq 365 aa AA seqDB search
MSIEVRIPNIAESISEVTISALLIPSGGLVQENQGILEIESDKVNQLIYAPCSGRVEWSV
SVGDTVAVGSVVGIISEAEKSQDTAPIHEQMPFSLVEQESDAQIIAFPSSVRQDPPAEGK
TFVPLKEIQPASSDHRESRESMSAIRKTISRRLVQSLHDSAMLTTFNEIHMGPLIALRKE
RQEDFVAKYGVKLGFMSFFVRAVVDSLKKYPRVNAYIEDNEIVYRHYYDISIAIGTDRGL
VVPVIRNCDQLSSGEIELQLADLASRAREGKLAIHELEGGGFTITNGGVYGSLLSTPIIN
PPQAGILGMHKIEKRPVVREDAIVIADMMYVAMSYDHRIIDGKEAVGFLVNVKEQLEQPE
LLLKM
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgagtatagaggttcgtattcccaatatcgcagaatccattagtgaagtgacgatttct
gcacttttgattccatcaggaggtttggtgcaggagaatcaagggattctggagatagag
agtgacaaggtgaatcagctcatttacgctccttgctcaggaagggtagagtggagcgtt
tccgtaggggatacggtcgctgttggtagtgttgtagggattattagtgaagcggaaaag
agtcaagatactgcacctatccatgagcagatgccatttagtcttgtagagcaggaaagc
gatgcgcagattattgccttcccttcatcagtgagacaggatcctcctgcagaagggaaa
acttttgttccattaaaggagatccaaccagcttcttctgatcatagagaatctcgagaa
tctatgagtgctattcggaagacgatttctcgtagattggtgcaatctctacatgattca
gcaatgttaacgacatttaatgaaatccatatggggccgcttattgctctgcgtaaggaa
agacaagaagatttcgttgcgaagtatggggtaaaactggggttcatgtctttctttgtt
agagccgttgtagattctttgaaaaaatatccccgggtgaatgcttatattgaagataac
gaaatcgtttacagacattactatgatatttccattgccatagggacagatcgtggatta
gtagttcctgtaattcgtaattgtgatcagttatctagcggggagattgagttacagctt
gccgatttagcttctcgtgctcgggaaggcaaacttgctattcatgagttagaaggggga
ggcttcactattaccaatggaggggtatacggttctcttctatccactcccattatcaat
cctccacaggcaggtattcttgggatgcacaagatagagaaacgccctgtggttagagaa
gatgcaattgtgatagccgatatgatgtatgtagctatgagctatgatcatcggattata
gacggaaaggaagccgtaggatttcttgtgaatgttaaagagcaattagaacaacccgag
cttttgctaaaaatgtag

DBGET integrated database retrieval system