KEGG   Chlamydia trachomatis E/11023: E11023_00455Help
Entry
E11023_00455      CDS       T01902                                 

Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
ctg  Chlamydia trachomatis E/11023
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ctg00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    E11023_00455
Enzymes [BR:ctg01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     E11023_00455
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(100153..101736)
Genome map
AA seq 527 aa AA seqDB search
MPSLSQSRRIIQQSSIRKIWNQIDTSPKHGVCVPLFSLYTQESCGIGEFLDLIPMIDWCI
SCGFQILQILPINDTGSCSSPYNSISSIALNPLHLSISALPYKEEVPAAETRIREMQQLS
QLPQVHYEKVRSMKRDFFQEYYRVCKQKKLTDHPDFYAFCEQEKYWLHPYALFRSIREYL
DNLPINHWPTTYTDLSQITEHERTFAEDIQFHSYLQYLCFQQMTQVREHANCKSCLIKGD
IPILISKDSCDVWFYRHYFSSSESVGAPPDLYNAEGQNWHLPIYNMKTLQQDNYLWWKER
LRYAENFYSLYRLDHVVGLFRFWVWDESGCGRFEPHNPKDYLAQGQDILSHLLTSSSMLP
IGEDLGTIPSDVKRMLESFAVCGTRIPRWERNWEGNGAYTPFDQYDPLSVTSLSTHDSST
LASWWKESPQESKLFAQFLGLPYSSTLSLHNHTEILKLSHKTSSIFRINLINDYLALFPD
LISKTPRYERINLPGTISKNNWVYRVKPSIEDLSSHSKLNSLLEALF
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
atgccgtcattatcccaatcccgacgtatcatccagcaatcttccattcgaaagatttgg
aatcagatagatacttctcctaagcatggcgtatgtgtaccgttattttctctctatact
caagaaagttgtgggataggtgaatttcttgacctgattcctatgatcgattggtgtatc
tcgtgtggttttcaaatccttcaaattcttccgattaacgatacagggtcctgttcgagt
ccttacaatagcatttcttcgatagcactcaatcctcttcacctttctatctctgcgctc
ccctataaagaagaagtgccagctgcggaaacacgcatacgagaaatgcagcaactctct
caacttcctcaagtacattatgaaaaagttcgctctatgaagagagatttttttcaagag
tactaccgcgtgtgtaaacagaaaaaactcactgatcatcctgatttttatgccttctgt
gaacaggaaaaatattggttacatccctacgctctctttcgctctatccgagaatatttg
gataaccttcctattaatcattggccaaccacctacacagatctctcccagattaccgag
catgaacgtacttttgcggaagatatacaatttcactcttatctacagtatttgtgcttc
caacagatgacacaagtgcgggagcatgccaattgcaaaagctgtctcatcaaaggggat
atccctattctaatcagtaaagatagctgcgatgtctggttttataggcattacttttcc
tcttcagaatctgtaggtgctcctcctgacctgtataatgcggaaggtcagaactggcat
ctccccatttataatatgaaaactttgcaacaagataactacctctggtggaaggagcgc
ttacgttatgcggagaatttttactctttataccgtcttgatcatgtcgtcggtctcttt
cgattttgggtatgggatgagtctggatgcggacgctttgaacctcataatccgaaagac
tatctagctcaagggcaagatatcttatctcacctcttgaccagttcatctatgctacct
ataggagaagatctgggaacgatcccttccgatgtgaaacgtatgctcgagtcttttgcc
gtatgcggcactagaattcctcgttgggaacgaaactgggaagggaatggagcctatacc
cctttcgatcaatacgaccctctatccgtcacaagcctctctactcatgattcctctaca
ttagcctcatggtggaaagaatctcctcaggaatccaaactatttgctcagtttttagga
ctcccctattcttccaccctatctcttcacaatcataccgaaatcctgaaactctctcac
aaaacctcttctatttttcgcatcaatcttattaatgactatctggctctgttcccggat
ttgatatcaaaaactcctcgctacgaaagaatcaatctgccaggaactatttcaaaaaat
aattgggtgtatcgagttaagccttctattgaagatttatcctctcattctaagctaaat
tctttacttgaggctctattttag

DBGET integrated database retrieval system