KEGG   Chlamydia trachomatis E/11023: E11023_00880Help
Entry
E11023_00880      CDS       T01902                                 

Definition
(GenBank) tryptophan synthase subunit beta
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
ctg  Chlamydia trachomatis E/11023
Pathway
ctg00260  Glycine, serine and threonine metabolism
ctg00400  Phenylalanine, tyrosine and tryptophan biosynthesis
ctg01100  Metabolic pathways
ctg01110  Biosynthesis of secondary metabolites
ctg01130  Biosynthesis of antibiotics
ctg01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ctg00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    E11023_00880
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    E11023_00880
Enzymes [BR:ctg01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     E11023_00880
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP Gmad2
Motif
Other DBs
NCBI-ProteinID: ADH20629
Position
193047..194225
Genome map
AA seq 392 aa AA seqDB search
MFKHKHPFGGAFLPEELLAPIQNLKAEWEILKTQQSFLSELDCILKNYAGRQTPLTEVKN
FARAIDGPRVFLKREDLLHTGAHKLNNALGQCLLAKYLGKTRVVAETGAGQHGVATATAC
AYLGLDCVVYMGAKDVERQKPNVEKMRFLGAEVVSVTKGSCGLKDAVNQALQDWATTHSF
THYCLGSALGPLPYPDIVRFFQSVISAEVKEQIHAVAGRDPDILIACIGGGSNAIGFFHH
FIPNPKVQLIGVEGGGLGISSGKHAARFATGRPGVFHGFYSYLLQDDDGQVLQTHSISAG
LDYPSVGPDHAEMHESGRAFYTLATDEEALRAFFLLTRNEGIIPALESSHALAHLVSIAP
SLPKEQIVIVNLSGRGDKDLPQIIRRNRGIYE
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgttcaaacataaacatccttttgggggagcgttccttcccgaagaactattagcccct
atacagaatctaaaagcggaatgggagattctcaaaactcagcaaagttttttatctgaa
ctagattgtattttgaaaaactatgcggggagacaaactcctctgactgaagttaagaat
tttgctcgagctattgatggccctagagtatttcttaaacgcgaagatcttttgcataca
ggagcacataaactgaataatgctcttggtcagtgtttgcttgctaaatatcttgggaaa
acacgtgttgtagctgaaacaggtgcgggacaacatggagtagcaacagcaacagcgtgt
gcttatctaggattagattgtgtagtatacatgggagcaaaagatgtggaacgacagaaa
ccaaatgtagagaaaatgcgctttttaggtgctgaagtcgtttctgtaacaaaaggatct
tgtggactcaaagatgcagttaatcaagctctacaagattgggcaacaacacactcattt
actcactattgcttaggatcggccttaggacctttaccttatcccgatatcgttcgattt
tttcagtctgttataagcgctgaagtgaaagagcaaatccatgcagttgcaggaagagat
cctgatattctgattgcatgtatcggaggtggctccaacgctattggatttttccatcat
tttatcccgaatccaaaagtccaattaattggagtggaagggggaggactgggcatttct
tcaggaaaacatgcagcacgttttgcaacagggcgacctggagtattccacggattttat
tcgtatcttcttcaagatgacgatggacaagtattacaaactcactccatttccgctgga
ttagattatccttcagttgggccagatcatgccgaaatgcatgagtcaggacgagccttt
tatacattagccaccgatgaagaggcgttacgagcttttttcctgcttactagaaacgag
gggattattcctgcattggagtcttcacatgctctcgcacatttagtttcgattgctcct
tctctaccaaaggaacaaatcgtcatcgttaacttatctggaagaggtgataaggatctt
ccacaaatcatccgcagaaacagaggaatttatgagtaa

DBGET integrated database retrieval system