KEGG   Chlamydia trachomatis E/11023: E11023_01055Help
Entry
E11023_01055      CDS       T01902                                 

Definition
diphosphate--fructose-6-phosphate 1-phosphotransferase (EC:2.7.1.90)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
ctg  Chlamydia trachomatis E/11023
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ctg00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    E11023_01055
   01230 Biosynthesis of amino acids
    E11023_01055
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    E11023_01055
   00030 Pentose phosphate pathway
    E11023_01055
   00051 Fructose and mannose metabolism
    E11023_01055
   00052 Galactose metabolism
    E11023_01055
  Energy metabolism
   00680 Methane metabolism
    E11023_01055
Enzymes [BR:ctg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     E11023_01055
Protein phosphatases and associated proteins [BR:ctg01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     E11023_01055
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
230488..232149
Genome map
AA seq 553 aa AA seqDB search
MSSNKHASLCQKTPSLCRELQKAPALLLTEDIRFKALLNERIDSVAELFPCTYNSPYYKF
ISKSDLSAETSPLKVGVMLSGGPAPGGHNVILGLLHSIKKLHPNSQLLGFIRNGEGLLNN
NTVEITDEFIEEFRNSGGFNCIGTGRTNIITEENKARCLQTANELDLDGLVIIGGDGSNT
ATAILAEYFAKHQAKTVLVGVPKTIDGDLQHLFLDLTFGFDTATKFYSSIISNISRDALS
CKGHYHFIKLMGRSSSHITLECALQTHPNIALIGEEIAEKSISLETLIHDICETIADRAA
MGKYHGVILIPEGVIEFIPEIQSLVKEIESIPEQENLYQALSLSSQQLLCQFPEDICHQL
LYNRDAHGNVYVSKISVDKLLIHLVRQHLETHFRQVPFNAISHFLGYEGRSGTPTHFDNV
YSYNLGYGAGVLVFNRCNGYLSTIEGLTSPIEKWRLRALPIVRMLTTKQGKDSKHYPLIK
KRLVDIASPVFNKFSLYRKIWALEDSYRFVGPLQIHSPEDAHSDDFPPLILFLNHNEWQK
RCSICLEIPDQDY
NT seq 1662 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtcgaataaacatgcttctctttgtcaaaagacgccttctttgtgtcgggagctt
caaaaagctcctgctcttctattaacagaagacataaggtttaaagctcttcttaatgaa
cgcattgactctgttgcagaactatttccatgcacttataactctccctactacaaattt
atttcgaagtccgatctttccgctgagacctctccccttaaagtgggcgttatgctttct
ggaggcccagctcctggtgggcacaatgtcatcttaggattgctacacagtattaaaaag
ctccatccgaatagtcagcttttaggatttattcgcaatggagaaggacttctcaataat
aatactgtagaaatcacagatgaattcattgaagagtttcgtaactctggaggctttaat
tgcataggaacaggtcgcactaatatcataaccgaagaaaataaagcgcgctgtttacaa
acagcaaatgaactcgatttagatggattagtgattattggaggcgatggttcgaataca
gccacggcgattcttgctgaatattttgctaagcatcaagcaaaaacggtattagttggt
gttcccaaaactattgatggagatttgcagcacctatttttagacctcacatttgggttt
gatactgctactaaattttattcatccatcatcagcaacatttctagagacgcattatcg
tgtaaaggccactatcattttattaaactaatgggccggtcttcttctcatatcacgcta
gaatgcgcactacagactcacccaaatattgctcttataggcgaagagattgcagaaaaa
agcatctccttagaaacattaatccatgatatttgtgaaacaatagcagatcgagctgct
atggggaaataccatggcgttattctcatccctgaaggagtcattgagtttattcctgaa
atacagtctctggttaaagaaattgaatccattccagagcaggagaatctttaccaagct
ttatccttatcttctcagcaacttttatgccaatttccggaagatatttgccatcagctc
ttgtataatagagatgctcatggcaacgtctatgtatcaaaaattagtgttgataaactt
ctgattcatctagttcgtcaacatttagaaacacattttagacaagttcccttcaatgca
atctcccattttttaggttatgaagggcgttcaggaactcctacacattttgataatgtg
tatagctataacttaggatatggtgctggggttctcgtttttaaccgctgtaatgggtat
ttatccacgatcgaaggtctaactagccctattgaaaaatggcgattgcgcgctttaccc
attgttcgaatgttgacgaccaagcaggggaaagacagtaaacattatcctctgataaaa
aaaagattggtagatattgctagtcctgtttttaataagttctcactgtatcggaaaatc
tgggctttagaagactcctatcgctttgtagggccattacaaatacattctccggaggat
gctcattctgatgattttcctcctttaattttgtttttgaatcataatgaatggcaaaaa
cgctgttctatttgtttagaaatccccgatcaggattattaa

  All links  
No link information was found.   
DBGET integrated database retrieval system