KEGG   Chlamydia trachomatis E/11023: E11023_02260Help
Entry
E11023_02260      CDS       T01902                                 

Gene name
hemD
Definition
uroporphyrinogen-III synthase (EC:4.2.1.75)
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
ctg  Chlamydia trachomatis E/11023
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ctg00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    E11023_02260 (hemD)
Enzymes [BR:ctg01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     E11023_02260 (hemD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
503387..504058
Genome map
AA seq 223 aa AA seqDB search
MPLYLGLNPSSAKQYSAVFQPIIRIVPFSKHVPQIRHARKFLVSASHILLTSPSSTACFF
SSIRKRIPLSLFRNKSFVTIGEATSSRVKAFLPKANIVQSAFPQAEAFLPILSTLPSSSS
LLYPHSVLARPILRSLLQTLPFSSFSYPHYTVKPITLSVSTFLPHKTIILTSPSIVRAYA
QLFPCLPDKEHWCLGEISAAEFKQIFHTPPSKILFSTKEPTGC
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atgcctctgtacttaggcctcaatccatcctctgctaaacaatattctgctgtttttcag
cctattattcgcatagtccctttttcaaaacacgttcctcaaatacgacatgctaggaag
ttccttgtatcagcttcccatattttgttaacaagcccctcttctaccgcttgttttttt
tcttccattaggaaaagaatccctttatccctgttcaggaataaatccttcgttaccata
ggagaagccacttcttctcgtgtaaaggcctttctccccaaagctaatattgtgcaaagc
gcattccctcaagcagaagcatttcttcccatcctatcgactcttccttccagctcctcc
ctactctatcctcactctgtactcgctcgtcccattctccgctctcttctacaaacactc
cctttctcctccttttcctatcctcattacacagttaaacccattacactttccgtaagt
acctttcttccccataaaactattattctcactagcccttctatcgttcgtgcctatgca
caactatttccctgcctccctgataaagaacactggtgtctaggagagattagtgcagca
gaattcaaacagatatttcacactcctccttccaaaattcttttttcaactaaagaaccg
acaggatgttga

DBGET integrated database retrieval system